[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39019.1
DDBJ      :             molybdopterin dehydrogenase, FAD-binding
Swiss-Prot:             

Homologs  Archaea  20/68 : Bacteria  249/915 : Eukaryota  13/199 : Viruses  0/175   --->[See Alignment]
d.145.1d.87.2
:268 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->264 1ffvC PDBj 5e-39 36.8 %
:RPS:PDB   6->264 2ckjA PDBj 6e-24 18.1 %
:RPS:SCOP  1->166 1rm6B2  d.145.1.3 * 2e-37 32.7 %
:RPS:SCOP  171->268 1fiqB1  d.87.2.1 * 2e-12 14.3 %
:HMM:SCOP  1->170 1rm6B2 d.145.1.3 * 3.5e-53 47.6 %
:HMM:SCOP  168->268 1n62C1 d.87.2.1 * 3.7e-19 34.0 %
:RPS:PFM   4->168 PF00941 * FAD_binding_5 4e-28 42.4 %
:HMM:PFM   3->167 PF00941 * FAD_binding_5 6e-52 41.8 165/171  
:HMM:PFM   196->263 PF03450 * CO_deh_flav_C 5.3e-06 28.4 67/103  
:BLT:SWISS 4->264 DCMM_HYDPS 6e-38 36.4 %
:PROS 24->34|PS00435|PEROXIDASE_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39019.1 GT:GENE ABE39019.1 GT:PRODUCT molybdopterin dehydrogenase, FAD-binding GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1997955..1998761 GB:FROM 1997955 GB:TO 1998761 GB:DIRECTION + GB:PRODUCT molybdopterin dehydrogenase, FAD-binding GB:PROTEIN_ID ABE39019.1 GB:DB_XREF GI:91682717 InterPro:IPR002016 InterPro:IPR002346 LENGTH 268 SQ:AASEQ MYEFKYHRPATVRQAANLLIKNEDAKLIAGGHTLLPVMKQRLAAPPHLVDLSHIEGLGGIEIKGRSLVIGATAKHAEVASSPIVGEAIPALAELASMIGDPAVRHKGTIGGSLANNDPTADYPAAVLALGATIVTNKRKLKPEEFFQGLFTTALEPDEIITKVLFPLPKKAAYIKFRNQASRYALVGVFVARRPSDVGVAVTGAGSDGVFRVSAFEEALKARFNSKSLDGIHVPHDGLNSDLHGSAEYRAHLIGVLAKRAVDAANGKA GT:EXON 1|1-268:0| BL:SWS:NREP 1 BL:SWS:REP 4->264|DCMM_HYDPS|6e-38|36.4|261/287| PROS 24->34|PS00435|PEROXIDASE_1|PDOC00394| BL:PDB:NREP 1 BL:PDB:REP 4->264|1ffvC|5e-39|36.8|261/287| RP:PDB:NREP 1 RP:PDB:REP 6->264|2ckjA|6e-24|18.1|259/1264| RP:PFM:NREP 1 RP:PFM:REP 4->168|PF00941|4e-28|42.4|165/171|FAD_binding_5| HM:PFM:NREP 2 HM:PFM:REP 3->167|PF00941|6e-52|41.8|165/171|FAD_binding_5| HM:PFM:REP 196->263|PF03450|5.3e-06|28.4|67/103|CO_deh_flav_C| GO:PFM:NREP 2 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00941|IPR002346| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00941|IPR002346| RP:SCP:NREP 2 RP:SCP:REP 1->166|1rm6B2|2e-37|32.7|165/216|d.145.1.3| RP:SCP:REP 171->268|1fiqB1|2e-12|14.3|98/114|d.87.2.1| HM:SCP:REP 1->170|1rm6B2|3.5e-53|47.6|168/0|d.145.1.3|1/1|FAD-binding domain| HM:SCP:REP 168->268|1n62C1|3.7e-19|34.0|100/109|d.87.2.1|1/1|CO dehydrogenase flavoprotein C-terminal domain-like| OP:NHOMO 480 OP:NHOMOORG 282 OP:PATTERN 112---2322223323--21111-----1--------------------------------1------ --311------------11-11--241111111222-1361112--------1-11----1-7--351211-----------3----------------------1------------------------------11111----5-----1-----------------1--------------1-------------------------1---1----1--------------------------------------------------------------------------------------------------------22--1111111111-----------1----1-1--122-112----------1-1--------74621124363111111111-1-33532524451-21122252113612---4311111224--------4112-211--------------------------------2--2221--------------34--------83561--2221-111111-31-2-----------------11-1-1------1------1111---1----1--2-------------------------111--1--1-1---------1---------------1------------1--1111111111-111111111111111111-------------------------11--1111-----------------------------111---------------111111----1122121112121221222-------------1---------------------------1-------------------------------------------12---------- --------------------------1--------------------1---------------------------------------------------------------1--------------------------------------------1-1----2------------11-8----1-131---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 268 STR:RPRED 100.0 SQ:SECSTR ccccEEEEcccHHHHHHHHHHcTTcEEccccTTHHHHHHHccccccEEEEccccGGGccEEEcccEEEEETTccHHHHHHcTTTTHHHHHHHHHHTTcccHHHHTTccHHHHHHcccTTcccHHHHHHHTcccETccccccccTTccccTTccccTTcEEEEEEEEcccTTEEEEEEEEccccccEEEEEEEEccTTccccEETcccccEEcTHHHHHHTTccccHHHHHHHHHTcccTTcTTccHHHHHHHHHHHHHHHHHHHHHHH DISOP:02AL 268-269| PSIPRED ccccEEcccccHHHHHHHHHcccccEEEEcccHHHHHHHcccccccEEEEccccccccEEEEEccEEEEEccccHHHHHccHHHHHHHHHHHHHHHHHccccccccccHHHHHHccccHHHHHHHHHHcccEEEEEEEEEEHHHHHHcccccccccccEEEEEEEEccccccEEEEEEccccccEEEEEEEEEEcccEEEEEcccccccccHHHHHHHHcccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHccc //