[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39025.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:125 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 30->122 Y1300_MYCBO 1e-04 34.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39025.1 GT:GENE ABE39025.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2003920..2004297 GB:FROM 2003920 GB:TO 2004297 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39025.1 GB:DB_XREF GI:91682723 LENGTH 125 SQ:AASEQ MGLSSAARCGAALLVALIVSSILTSAEAAGAFAVGKCGAYGKAFDYPAEAAAIAAARKQCRGDCTTITMRRACAALAIDLLNPCGPHGYAVEPKISSSLNEATRKCYEYGGKECVIRAWACDAKG GT:EXON 1|1-125:0| BL:SWS:NREP 1 BL:SWS:REP 30->122|Y1300_MYCBO|1e-04|34.5|84/124| TM:NTM 1 TM:REGION 9->31| SEG 48->56|aeaaaiaaa| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,124-124| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHcHHHcccHHcccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccEEccHHHHHHHHHHHHHHHHcccEEEEEEEEEcccc //