[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39028.1
DDBJ      :             putative efflux protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  247/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.46.1
:266 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   90->187 3fppB PDBj 1e-05 33.7 %
:RPS:PDB   127->193 2ejmA PDBj 1e-09 11.9 %
:RPS:SCOP  29->250 1t5eA  f.46.1.1 * 3e-17 14.0 %
:HMM:SCOP  24->182 1vf7A_ f.46.1.1 * 6.6e-20 30.2 %
:RPS:PFM   37->142 PF00529 * HlyD 1e-05 31.1 %
:HMM:PFM   40->122 PF00529 * HlyD 1.2e-12 36.1 83/306  
:HMM:PFM   130->161 PF00364 * Biotin_lipoyl 6.8e-05 31.2 32/74  
:HMM:PFM   211->257 PF12158 * DUF3592 0.00064 21.7 46/148  
:BLT:SWISS 30->67 AN36_HELPY 3e-04 42.1 %
:BLT:SWISS 108->233 YHII_ECOLI 7e-13 35.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39028.1 GT:GENE ABE39028.1 GT:PRODUCT putative efflux protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2005509..2006309 GB:FROM 2005509 GB:TO 2006309 GB:DIRECTION + GB:PRODUCT putative efflux protein GB:PROTEIN_ID ABE39028.1 GB:DB_XREF GI:91682726 LENGTH 266 SQ:AASEQ MIARPIQAALALSMLVAFAGCSNTTDPGYQGWVEADLIFVSPDESGRVTKLTVREGDETRKGDLIYTLDDDLQQADLNQNNATLANARQSFDRAQSLSKTGSGTQANLDAAVSALRVAEARVETSKTRLMRREIRAPVTGTVQQIYFREGEMAAAQKPVLSILPPGNMKLRFFVPEAALPKLSIGDEIRVTCDNCAPDLTARIYYIATTAEYTPPVIYSLDERNKLVYLIQARPDRPTSLRVGQPINVYVKPKSPAQPPAAAGGKS GT:EXON 1|1-266:0| BL:SWS:NREP 2 BL:SWS:REP 30->67|AN36_HELPY|3e-04|42.1|38/329| BL:SWS:REP 108->233|YHII_ECOLI|7e-13|35.2|125/355| SEG 68->89|ldddlqqadlnqnnatlanarq| SEG 251->265|kpkspaqppaaaggk| BL:PDB:NREP 1 BL:PDB:REP 90->187|3fppB|1e-05|33.7|98/267| RP:PDB:NREP 1 RP:PDB:REP 127->193|2ejmA|1e-09|11.9|67/99| RP:PFM:NREP 1 RP:PFM:REP 37->142|PF00529|1e-05|31.1|106/259|HlyD| HM:PFM:NREP 3 HM:PFM:REP 40->122|PF00529|1.2e-12|36.1|83/306|HlyD| HM:PFM:REP 130->161|PF00364|6.8e-05|31.2|32/74|Biotin_lipoyl| HM:PFM:REP 211->257|PF12158|0.00064|21.7|46/148|DUF3592| GO:PFM:NREP 3 GO:PFM GO:0008565|"GO:protein transporter activity"|PF00529|IPR006143| GO:PFM GO:0009306|"GO:protein secretion"|PF00529|IPR006143| GO:PFM GO:0016020|"GO:membrane"|PF00529|IPR006143| RP:SCP:NREP 1 RP:SCP:REP 29->250|1t5eA|3e-17|14.0|222/231|f.46.1.1| HM:SCP:REP 24->182|1vf7A_|6.6e-20|30.2|159/237|f.46.1.1|1/1|HlyD-like secretion proteins| OP:NHOMO 280 OP:NHOMOORG 247 OP:PATTERN -------------------------------------------------------------------- -1----------------------------------------------------------------------------------------1--1-------1---2-2-1---------------1-----11-11-------------1----------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------1-------------11----------------111---1-----------2--2-----222221-12111111121211111-1111111--23-111----1----13--1--2-------11111111111--121----1111-----------------------1--11---12--1-1---1111-11111-11111112--111---111-111-1-111---1-------1-111--1111-1111111--1-1221--1------1-----1-----------------1--111-2----1-----------1----11-----------------1------11111111-1-11-11111111111111112221---11-11111111111111-11-1111------------------111111121-11111111111----1-----11--------1112-2221-----1112-11------111------1--------------------------------------------------------------------------1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 132 STR:RPRED 49.6 SQ:SECSTR #######################################EEccccEEEEEEcccTTcEEcTTcEEEE######################HHHHHHHHHHccccTTHHHEEEEEEEEcccccccccccccccccccccccEEEEEEcccTTEEEccccEEEEEEccccEEEEEccccEEEEEEcccTTEEEcTT######################################################################### DISOP:02AL 1-2,101-101,256-267| PSIPRED ccccccHHHHHHHEEEEEEEccccccccEEEEEEEEEEEEEcccccEEEEEEcccccEEccccEEEEEcccHHHccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEccccEEEEEEEEccccEEcccccEEEEEEcccEEEEEEEcHHHHHHcccccEEEEEEcccccEEEEEEEEEEcccccccccccccccEEEEEEEEEEEEccccccccccEEEEEEEccccccccccccccc //