[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39032.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:237 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   176->233 PF07217 * Het-C 7e-04 40.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39032.1 GT:GENE ABE39032.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2009824..2010537) GB:FROM 2009824 GB:TO 2010537 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39032.1 GB:DB_XREF GI:91682730 LENGTH 237 SQ:AASEQ MSSASLSPSTELFSASSPASVDPLSGGSKADQVLLFGGYDLWRNGVSNYAGLHWATNGLNDDGFILRLSMSNGLDSYRTRSRTYTTEIFRAALLPGWRFKRGEFEVKLFVGPDFENHKLTPDSLTAKWRGAHLGLRIAAETWAQPIPELMLAASFYAATIASGYGFRAAAGWRLIDAFWLGPELSGSRDEFSRQTRFGIHLTGLQSGPFEWSAAFGYVRDSFGRCGGYGRLATQMRL GT:EXON 1|1-237:0| SEG 76->86|syrtrsrtytt| RP:PFM:NREP 1 RP:PFM:REP 176->233|PF07217|7e-04|40.0|55/579|Het-C| OP:NHOMO 15 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111------------21-11-11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11,237-238| PSIPRED ccccccccccccccccccccccccccccccccEEEEEEHHHHccccHHHccHHHHcccccccccEEEEEEccHHHHHHccccEEEEEEEEEEccccEEEEcccEEEEEEEcccccccccccccccEEEEEcccEEEEEEEEEccccHHHHHHHHHHHEEcccccHHHHHHHHHHHHHHHHcHHHHcccccEEEEEEEEEEEEccEEccEEEEEEEEEHHHcccccccHHHHHHHccc //