[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39050.1
DDBJ      :             binding-protein-dependent transport systems inner membrane component
Swiss-Prot:             

Homologs  Archaea  56/68 : Bacteria  791/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:326 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  97->322 2r6gG1  f.58.1.1 * 8e-13 14.7 %
:RPS:PFM   111->319 PF00528 * BPD_transp_1 3e-10 30.6 %
:HMM:PFM   112->319 PF00528 * BPD_transp_1 1.1e-44 37.2 183/185  
:BLT:SWISS 1->319 Y209_BRUME 2e-63 40.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39050.1 GT:GENE ABE39050.1 GT:PRODUCT binding-protein-dependent transport systems inner membrane component GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2031157..2032137) GB:FROM 2031157 GB:TO 2032137 GB:DIRECTION - GB:PRODUCT binding-protein-dependent transport systems inner membrane component GB:PROTEIN_ID ABE39050.1 GB:DB_XREF GI:91682748 InterPro:IPR000515 LENGTH 326 SQ:AASEQ MLAFTLRRMLQAIGVMIVVCALSFAMFRFAGDPVSQIVSIDTSTAERAEIRKSLGLDDPVLLQFGRYFVNAAQFDFGMSYRFREPVAKLLLERMPATLELATCATVLAMTLGILLGVYTALRRNSWLATLMQAVSLIGISLPTFLIGILLIYLFAVVLGWLPSYGRGETVRFGWWTTGLLTTSGLKSLIMPSITLGLFQMTLIMRLVRAEMLEVLRTDYIRFARARGLTTRAIHFGHALKNTLVPVITVAGLQFGSVIAFAIITETVFQWPGMGLLFVQAVQNVDIPIMAAYLLVVSLIFVTINLVVDILYTLVDPRLRASAARRT GT:EXON 1|1-326:0| BL:SWS:NREP 1 BL:SWS:REP 1->319|Y209_BRUME|2e-63|40.1|309/315| TM:NTM 6 TM:REGION 12->34| TM:REGION 99->121| TM:REGION 133->155| TM:REGION 182->204| TM:REGION 246->268| TM:REGION 282->304| SEG 176->188|ttgllttsglksl| RP:PFM:NREP 1 RP:PFM:REP 111->319|PF00528|3e-10|30.6|193/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 112->319|PF00528|1.1e-44|37.2|183/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 97->322|2r6gG1|8e-13|14.7|204/284|f.58.1.1| OP:NHOMO 3620 OP:NHOMOORG 853 OP:PATTERN 4441313255555444352232113336435212---1-----113-52-EA5-54432133314-11 -113D443444-4122322-22112A2222224333287A19297EB536648A732611552395987A43333733323-411111--------2--------11--111111111222222211111111121465952216A3322333221111111132215322111111111111A5433991423666664564546445A76663655314C521222222E6155545555655556333322222342-12111--33111112234333333311112211111112222222222222231111211111C36244434541422222111143153A-111BA631-282-3462164411----1121132HHO115854B19AAA9AA8AAL-44C43A4DQP1-mRRWJJEXUMOPK4-116CDA6AA6DF1111111123322219-------------------------------11--CFBCC68888654555559955552567E64A7113342363353D5DS241132242-------111221346132352234431111111211----13111111------112222212214-1211653121111151111111211111121111--13321------76KE4987777777777-7777777777777676776BCBCA3366666666666666666976666674-666666656666--111111111111174854412233322423222222121235333233658165441ABA1----1---246665555556688--1-------------12111111111111116-111111-3-2221-22212212211143854AEA88212 -----------------------------------------------------------------------------------------------------------------1--------------------------------------------1----4---------1-----------1--1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 319-319,321-327| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcccc //