[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39063.1
DDBJ      :             Phenylacetate-CoA oxygenase, PaaJ subunit
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  147/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.52.8
:166 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   7->103 3cq1A PDBj 1e-24 28.4 %
:RPS:SCOP  7->103 1uwdA  d.52.8.2 * 5e-23 26.0 %
:HMM:SCOP  7->105 1uwdA_ d.52.8.2 * 1.5e-23 38.8 %
:RPS:PFM   11->74 PF01883 * DUF59 2e-09 44.4 %
:RPS:PFM   111->158 PF01921 * tRNA-synt_1f 5e-04 25.0 %
:HMM:PFM   12->82 PF01883 * DUF59 2.6e-19 38.6 70/76  
:HMM:PFM   123->161 PF03811 * Ins_element1 0.00043 27.0 37/88  
:BLT:SWISS 15->165 PAAD_ECOLI 2e-40 52.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39063.1 GT:GENE ABE39063.1 GT:PRODUCT Phenylacetate-CoA oxygenase, PaaJ subunit GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2045140..2045640 GB:FROM 2045140 GB:TO 2045640 GB:DIRECTION + GB:PRODUCT Phenylacetate-CoA oxygenase, PaaJ subunit GB:PROTEIN_ID ABE39063.1 GB:DB_XREF GI:91682761 InterPro:IPR002744 InterPro:IPR011883 LENGTH 166 SQ:AASEQ MSPAPGDAELRQRAWDAAATVVDPEIPVLTIADLGVLREVSVAEGRVEIAITPTYSGCPAMNMITLEIEMALARAGISDARVRTVLAPAWTTDWMSAEGRAKLKDYGIAPPQIASSRRALFGTLEIACPQCGSIDTEQLSEFGSTSCKALWRCKACREPFDYFKCH GT:EXON 1|1-166:0| BL:SWS:NREP 1 BL:SWS:REP 15->165|PAAD_ECOLI|2e-40|52.7|148/167| RP:PDB:NREP 1 RP:PDB:REP 7->103|3cq1A|1e-24|28.4|95/98| RP:PFM:NREP 2 RP:PFM:REP 11->74|PF01883|2e-09|44.4|63/76|DUF59| RP:PFM:REP 111->158|PF01921|5e-04|25.0|48/354|tRNA-synt_1f| HM:PFM:NREP 2 HM:PFM:REP 12->82|PF01883|2.6e-19|38.6|70/76|DUF59| HM:PFM:REP 123->161|PF03811|0.00043|27.0|37/88|Ins_element1| GO:PFM:NREP 6 GO:PFM GO:0000166|"GO:nucleotide binding"|PF01921|IPR002904| GO:PFM GO:0004824|"GO:lysine-tRNA ligase activity"|PF01921|IPR002904| GO:PFM GO:0005524|"GO:ATP binding"|PF01921|IPR002904| GO:PFM GO:0005737|"GO:cytoplasm"|PF01921|IPR002904| GO:PFM GO:0006412|"GO:translation"|PF01921|IPR002904| GO:PFM GO:0006430|"GO:lysyl-tRNA aminoacylation"|PF01921|IPR002904| RP:SCP:NREP 1 RP:SCP:REP 7->103|1uwdA|5e-23|26.0|96/102|d.52.8.2| HM:SCP:REP 7->105|1uwdA_|1.5e-23|38.8|98/0|d.52.8.2|1/1|Fe-S cluster assembly (FSCA) domain-like| OP:NHOMO 167 OP:NHOMOORG 150 OP:PATTERN ------------------------1---------------------------------------1--- ----1--1--1---1---------------------11111------1----111111--111-111111------------1--1--11---------1-----2---1--------------------------------------------------------1----------------22222---1------------------1--------33--1-------1----------------------------------------------------------------------------------11---111-----------------------------1---------------------1-------------1111--11111-----------------2------------1---11-1---111-----11--------1---------------------------------------1--111111111112111211111111111112221--11111---1-1-11-------------------211---------------------------------------------------------------------1------------------1--------------------1---1---11--111---1-1-----1--1111---------------------1--------------------------------------1---------------11111-----------11---1111----------------------------------------------------------------------------------------------------1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 96 STR:RPRED 57.8 SQ:SECSTR ######ccHHHHHHHHHHTTcccTTTcc#cTTTTTcEEEEEEETTEEEEEEcccccccccccHHHHHHHHHHHTTTccEEEEEEcccccccGGGcccGGGTTT############################################################### DISOP:02AL 1-4,112-123| PSIPRED cccccccHHHHHHHHHHHHccccccccccccEEcccEEEEEEEccEEEEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEEEEcccccHHHccHHHHHHHHHHccccccccccccccccccccccccccccccEEEccccccHHHHHHHHHHHHcHHHHcccc //