[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39067.1
DDBJ      :             Enoyl-CoA hydratase
Swiss-Prot:             

Homologs  Archaea  33/68 : Bacteria  620/915 : Eukaryota  161/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:261 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->259 3gowF PDBj 5e-37 45.4 %
:RPS:PDB   2->258 2ej5B PDBj 5e-39 35.2 %
:RPS:SCOP  8->256 1uiyA  c.14.1.3 * 1e-46 26.6 %
:HMM:SCOP  2->256 2fw2A1 c.14.1.3 * 8.3e-81 42.0 %
:RPS:PFM   15->178 PF00378 * ECH 6e-23 43.2 %
:HMM:PFM   14->181 PF00378 * ECH 5.2e-48 38.0 166/170  
:BLT:SWISS 15->259 PAAG_ECOLI 4e-59 54.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39067.1 GT:GENE ABE39067.1 GT:PRODUCT Enoyl-CoA hydratase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2048838..2049623) GB:FROM 2048838 GB:TO 2049623 GB:DIRECTION - GB:PRODUCT Enoyl-CoA hydratase GB:FUNCTION phenylacetate degradation GB:PROTEIN_ID ABE39067.1 GB:DB_XREF GI:91682765 InterPro:IPR001753 InterPro:IPR011968 LENGTH 261 SQ:AASEQ MDEILIDDRGSWRVVTLNRPDRLNSFNEAMHRALASALDEARDPACRGVLLTGAGRGFCAGQDLADVTVAEGSAPDLGVTIETFYNPLVRQIRGLDKPVVCAVNGTAAGAGANIALACDLVIAARSAKFIQSFAKIGLVPDSGGTWFLPRLIGDARARGLAMLAEPISAETAANWGLIWRVADDDRLISEAEALTAHLATQPTQGLALIKQALAAAATSTLDAQLDLERDLQRQAGRTPDYAEGVDAFIGKRAPTFTGRAH GT:EXON 1|1-261:0| BL:SWS:NREP 1 BL:SWS:REP 15->259|PAAG_ECOLI|4e-59|54.7|245/262| SEG 99->117|vvcavngtaagaganiala| SEG 206->227|lalikqalaaaatstldaqldl| BL:PDB:NREP 1 BL:PDB:REP 14->259|3gowF|5e-37|45.4|240/252| RP:PDB:NREP 1 RP:PDB:REP 2->258|2ej5B|5e-39|35.2|247/251| RP:PFM:NREP 1 RP:PFM:REP 15->178|PF00378|6e-23|43.2|162/170|ECH| HM:PFM:NREP 1 HM:PFM:REP 14->181|PF00378|5.2e-48|38.0|166/170|ECH| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00378|IPR001753| GO:PFM GO:0008152|"GO:metabolic process"|PF00378|IPR001753| RP:SCP:NREP 1 RP:SCP:REP 8->256|1uiyA|1e-46|26.6|248/253|c.14.1.3| HM:SCP:REP 2->256|2fw2A1|8.3e-81|42.0|255/0|c.14.1.3|1/1|ClpP/crotonase| OP:NHOMO 3163 OP:NHOMOORG 814 OP:PATTERN 22-1--5977787876-121211961231227------------------------------311-11 22229114--121-EQHAA-AG33COBBBBBBIMRMBIYV1J2A-1121--1111232--76A-6775337--------1415-----1111-121---2-111142211--------------11111111111144422---4611111111111---1-1111-1121-1-1---1-1--33322---5435555544646364433644446643774542------7-111111111111111111111-1----1-----11---1---111111111111111111111111111111111111111111111111--1131111111212-2221221-2-1-2-11-441425-15---1--2-4--866D-----2-NDD322NFJCB34443442443-213-2A2956K-533134754587684E6677355547A--------5---1A63------------------------------BBJB-4QICH6AB8F97888799BA999868D8QEPUN11894675A6D8FBBO227----34----------D882P571----------5561D13--13225412---------------------------211131414131222212511123153222-------------211121-4222422244-244422242422222422433311112222222222222222231122222--111111111111---1-----1111-251311111111111111188768272332177776656389873233----------111211111241212232322222-------1222221-----------------------------------------------11 ----523-211-23323217465221245233322215222333132225665422112111111-------1-1--------------24-31231111111253-67166542433111231941113A2-234--1142232-24211--4112274432644-333596332331-3412353333231234311 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 259 STR:RPRED 99.2 SQ:SECSTR cccEEEEEETTEEEEEEccGGGTTcccHHHHHHHHHHHHHHHcTTccEEEEEEcccccccccccccHHHHHTccHHHHHHHHHTHHHHHHHHHHccccEEEEEccEEETHHHHHHHHccEEEEETTcEEEccGGGGTccccTTHHHHHHHHHcHHHHHHHHHHcccEEHHHHHHHTcccEEEcGGGHHHHHHHHHHHHHHccHHHHHHHHHHHHHTTTccHHHHHHHHHHHHHHHHTcHHHHHHHHHHHTTcccccccH## DISOP:02AL 257-262| PSIPRED ccEEEEEEEccEEEEEEccHHHHccccHHHHHHHHHHHHHHccccccEEEEEcccccccccccHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccEEEEEEEEEEccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccccEEccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccccc //