[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39089.1
DDBJ      :             3-hydroxyisobutyrate dehydrogenase
Swiss-Prot:             

Homologs  Archaea  25/68 : Bacteria  538/915 : Eukaryota  160/199 : Viruses  0/175   --->[See Alignment]
a.100.1c.2.1
:304 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->291 3g0oA PDBj 1e-40 46.5 %
:RPS:PDB   8->301 3ckyC PDBj 5e-58 30.7 %
:RPS:SCOP  8->167 1vpdA2  c.2.1.6 * 2e-31 28.1 %
:RPS:SCOP  170->293 3cumA1  a.100.1.1 * 1e-20 25.0 %
:HMM:SCOP  7->168 2cvzA2 c.2.1.6 * 7.7e-39 38.5 %
:HMM:SCOP  170->300 2cvzA1 a.100.1.1 * 2.6e-37 39.7 %
:RPS:PFM   8->167 PF03446 * NAD_binding_2 2e-18 39.5 %
:HMM:PFM   8->167 PF03446 * NAD_binding_2 2.4e-48 35.0 160/163  
:BLT:SWISS 9->304 YGBJ_ECOLI 2e-60 49.5 %
:PROS 11->24|PS00895|3_HYDROXYISOBUT_DH
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39089.1 GT:GENE ABE39089.1 GT:PRODUCT 3-hydroxyisobutyrate dehydrogenase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2073048..2073962 GB:FROM 2073048 GB:TO 2073962 GB:DIRECTION + GB:PRODUCT 3-hydroxyisobutyrate dehydrogenase GB:PROTEIN_ID ABE39089.1 GB:DB_XREF GI:91682787 InterPro:IPR002204 InterPro:IPR006115 LENGTH 304 SQ:AASEQ MTGTARPRVAVIGLGSMGFGMAASLRRAGFIVIGCDVSAETVARFAAEGGHGAATPAEAAKDVSIVVSVVVNAAQTEDVLFGETGVAASLANDAVFVSCATMDPDVARRLAAKLEATGRHYLDAPISGGAQRAAHGELTILASGSAAAFERARPALDAMAAKLYELGDAAGQGAAFKMINQLLAGVHIAAASEAIAFAARQGLDIRKVYEVITASAGNSWMFENRVPHVLDGDYTPRSAVDIFVKDLGIVQDMARAAKFPVPLSAAALQMFLMTSAAGMGRDDDASVAKMYAQVTGTKLPGDKA GT:EXON 1|1-304:0| BL:SWS:NREP 1 BL:SWS:REP 9->304|YGBJ_ECOLI|2e-60|49.5|293/302| PROS 11->24|PS00895|3_HYDROXYISOBUT_DH|PDOC00697| SEG 63->71|vsivvsvvv| SEG 184->199|agvhiaaaseaiafaa| BL:PDB:NREP 1 BL:PDB:REP 9->291|3g0oA|1e-40|46.5|269/273| RP:PDB:NREP 1 RP:PDB:REP 8->301|3ckyC|5e-58|30.7|293/296| RP:PFM:NREP 1 RP:PFM:REP 8->167|PF03446|2e-18|39.5|157/160|NAD_binding_2| HM:PFM:NREP 1 HM:PFM:REP 8->167|PF03446|2.4e-48|35.0|160/163|NAD_binding_2| GO:PFM:NREP 3 GO:PFM GO:0004616|"GO:phosphogluconate dehydrogenase (decarboxylating) activity"|PF03446|IPR006115| GO:PFM GO:0006098|"GO:pentose-phosphate shunt"|PF03446|IPR006115| GO:PFM GO:0055114|"GO:oxidation reduction"|PF03446|IPR006115| RP:SCP:NREP 2 RP:SCP:REP 8->167|1vpdA2|2e-31|28.1|160/161|c.2.1.6| RP:SCP:REP 170->293|3cumA1|1e-20|25.0|124/134|a.100.1.1| HM:SCP:REP 7->168|2cvzA2|7.7e-39|38.5|156/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 170->300|2cvzA1|2.6e-37|39.7|131/0|a.100.1.1|1/1|6-phosphogluconate dehydrogenase C-terminal domain-like| OP:NHOMO 1849 OP:NHOMOORG 723 OP:PATTERN ------1122222221-411111----1-1-------------1------1----1------11--11 124-111-------53311-13--181111115646247622281121----546312--1-1-1-62221-------1---3111-------------------1-2----------------------------31122---13221-222----21212211-11111-111---1-11-121-1---2121121222222222223122222222222221111111211-------------------1-1-11-1---11--111111111-1---------------------------------------------1-11-------1-1-1---11------111--33-----1---------3122221-----427972233633211231333224-22822B2A452-444454686678772224342222647111111117--22111-----------------------------32242-3963A7887776111-669C44452594F8A75-4553343335285761221--1231111111111222-12--22-111--2-2-21222-111111--11------------------------1121223-222322222223222222222222---1112------2211-114334454544-34444444243433444413332211-424443444443434413212233---11111111111----1111-1111133531113-2--1-1111133223131123-66663543433343323----------311211111332221132222222------2---------------1-1------------------1----------------1-- ----111-422-111614333333523222222222122222222232-1144522211111---------------------------11111111111111211-29345435321111122321416I2-33512212-222121222124-32232234222132C111211322H232-255A82743365444 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 301 STR:RPRED 99.0 SQ:SECSTR cEEEcTTEEEEEcccTTHHHHHHHHHHTTcEEEEEcccHHHHHHHHTTTcEEcccHHHHHHHccEEEEccccHHHHHHHHTcTTcHHHHccTTcEEEEcccccHHHHHHHHHHHHHTTcEEEEccEEcHHHHHHHTcEEEEEEccHHHHHHHHHHHHHHEEEEEEEEccTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHTcTTccHHHHHHcccccTccccccccHHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHTTcTTccGGGGHHHHHHHHcccccc### DISOP:02AL 1-4,297-305| PSIPRED cccccccEEEEEEccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHcccEEcccHHHHHHcccEEEEEEEcHHHHHHHHccHHHHHcccccccEEEEcccccHHHHHHHHHHHHHccccEEEccccccHHHHHcccEEEEEcccHHHHHHHHHHHHHHHccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccc //