[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39098.1
DDBJ      :             aminoglycoside phosphotransferase
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  149/915 : Eukaryota  54/199 : Viruses  0/175   --->[See Alignment]
d.144.1
:329 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   182->242 3dxpA PDBj 4e-07 50.0 %
:RPS:PDB   13->304 3dxqB PDBj 1e-17 17.8 %
:RPS:SCOP  2->324 1zylA1  d.144.1.6 * 8e-14 13.7 %
:HMM:SCOP  11->286 1nd4A_ d.144.1.6 * 4.8e-37 30.2 %
:RPS:PFM   30->234 PF01636 * APH 8e-17 34.0 %
:HMM:PFM   28->258 PF01636 * APH 4.1e-37 31.8 214/238  
:BLT:SWISS 21->313 ACD10_HUMAN 8e-19 29.9 %
:PROS 199->211|PS00109|PROTEIN_KINASE_TYR

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39098.1 GT:GENE ABE39098.1 GT:PRODUCT aminoglycoside phosphotransferase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2084695..2085684 GB:FROM 2084695 GB:TO 2085684 GB:DIRECTION + GB:PRODUCT aminoglycoside phosphotransferase GB:PROTEIN_ID ABE39098.1 GB:DB_XREF GI:91682796 InterPro:IPR002575 InterPro:IPR008266 LENGTH 329 SQ:AASEQ MSAAFEDALARSVQNWCAGATGIRAAAQLSGGASQETWAFTIERPDGDVDAILRRAPPGYGAAPSRAAGLDAEAELMRLSYDAGVPSPRVLHVLTEADQCGTGFIMQRVEGETIPRKILRDAQFATARPMLARQLGGILAGIHGIESAALPALRTMSSTEEIAQLDAEYRSFGWPRPVFELALRWLSRHDPGVSKKITLVHGDFRHGNLIIGPDGVRAVLDWELAHLGDPMEDLGWVCVNSWRFGEIDKPVGGLGSREEMFAGYEAGGGNVDADRVKFWEVMGTLRWGIMCCGMMQRFRQGPDHSMERAMIGRRSSETEIDLLRILAPL GT:EXON 1|1-329:0| BL:SWS:NREP 1 BL:SWS:REP 21->313|ACD10_HUMAN|8e-19|29.9|281/1059| PROS 199->211|PS00109|PROTEIN_KINASE_TYR|PDOC00100| BL:PDB:NREP 1 BL:PDB:REP 182->242|3dxpA|4e-07|50.0|58/312| RP:PDB:NREP 1 RP:PDB:REP 13->304|3dxqB|1e-17|17.8|247/280| RP:PFM:NREP 1 RP:PFM:REP 30->234|PF01636|8e-17|34.0|191/221|APH| HM:PFM:NREP 1 HM:PFM:REP 28->258|PF01636|4.1e-37|31.8|214/238|APH| RP:SCP:NREP 1 RP:SCP:REP 2->324|1zylA1|8e-14|13.7|307/325|d.144.1.6| HM:SCP:REP 11->286|1nd4A_|4.8e-37|30.2|245/255|d.144.1.6|1/1|Protein kinase-like (PK-like)| OP:NHOMO 381 OP:NHOMOORG 206 OP:PATTERN ------------------------1-----11------------------------------------ ----2------1-126511-13--241111122555255B-4-4------------------1-1321-------------------------------------------------------------------------------------------------------------------111-1---1---------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------4334-------222---2-222--------------1--1-2-14--------------1-3211-----1-2--------1-----1-------------------------------2322-----11111112222211122222121131643-1111-1122111211-----------------------211------------------------11--------------------------------2---12--------2-----1--------------------------------------------------------------------------------------------------------------------11-------------------1---1-11--121211-1121111111------------------------------------------111111------------------------------------------------- -----------------1----------------------------------------------------------------------------------1--2---21-2-2--121--111-31-319F2-32611112--11-111-2--113222133-11--------11-1----1--12--1-12------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 295 STR:RPRED 89.7 SQ:SECSTR THHHHHHHHHHHHHHHHTGGTTccccEEEccccccEEEEET####ccccTEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccEEEEcTTT####TccEEEccTTcEEcHHHHHH#HHHHHcTTHHHHHHHHHHHHHTccccccccccHHHHHHHHHHHTTccccccTTHHHHHHHHHHHHHHHHTcccccEEEcccccGGGEEEccccccEEcccTTcEEEcHHHHHHHHHHHHTTccHHHccTTccHHHHHHHHHHTcccccHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccccH######################### DISOP:02AL 1-3| PSIPRED ccccHHHHHHHHHHHcccccccccEEEEccccccccEEEEEEEccccccEEEEEEccccccccccccccHHHHHHHHHHHHHcccccccEEEEccccccccHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccEEEEEcccccccEEEccccEEEEEEccccccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccc //