[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39141.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:106 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   31->53 PF06906 * DUF1272 0.001 26.1 23/57  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39141.1 GT:GENE ABE39141.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2143823..2144143 GB:FROM 2143823 GB:TO 2144143 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39141.1 GB:DB_XREF GI:91682839 LENGTH 106 SQ:AASEQ MARQLVYRCPQNGLMTQTWLADEVVGGDRLTYELVFCLACSQQHFICVETGRALGDRVEATTTTHVPTFPPDQIKASGDRVGVQRDADAYSPRGVAAPAGDYAKAH GT:EXON 1|1-106:0| HM:PFM:NREP 1 HM:PFM:REP 31->53|PF06906|0.001|26.1|23/57|DUF1272| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,100-101,103-107| PSIPRED cccEEEEEcccccccHHHHHHHHHcccccccccEEEEcccccEEEEEHHccccccccEEEEEEccccccccHHHHHHcccccHHHHHHHccccccccccccHHccc //