[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39144.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:231 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39144.1 GT:GENE ABE39144.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2146839..2147534) GB:FROM 2146839 GB:TO 2147534 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39144.1 GB:DB_XREF GI:91682842 LENGTH 231 SQ:AASEQ MKREASGRSALIFAIALCACFSGPMLPAAGVAAPAASQDAASPAAKKKTVNAHTPQKPPPAKPTAEKTKDASRLDSVATTPAEVTPEGAIETTAPTAIAPPSAALAPSIANANAQFPPVTHDAASSDAIVSQATPDPSRAHQTADDRHVVAPDEVNELDRAAGDTPPPAVMAASTTEPTIAAPAPTTVGAAQVSSATSNDGAWDKASLIGKIFIAAGGLLTLASAARMFMA GT:EXON 1|1-231:0| SEG 27->45|paagvaapaasqdaaspaa| SEG 52->71|ahtpqkpppakptaektkda| SEG 85->114|tpegaiettaptaiappsaalapsianana| SEG 172->191|aastteptiaapapttvgaa| SEG 215->226|aagglltlasaa| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9,36-72,134-134,136-138,192-201| PSIPRED ccccccccHHHHHHHHHHHHHccccccccccccccccccccccHHHccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHcccccccccccccccccHHHHHHccccccccccccccccEEcHHHHHHHHHHHcccccHHHHHHcccccccccccccccccHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHcc //