[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39146.1
DDBJ      :             protein of unknown function DUF1109
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:212 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   44->191 PF06532 * DUF1109 8e-13 33.1 %
:HMM:PFM   10->212 PF06532 * DUF1109 1.1e-64 47.8 203/204  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39146.1 GT:GENE ABE39146.1 GT:PRODUCT protein of unknown function DUF1109 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2148354..2148992 GB:FROM 2148354 GB:TO 2148992 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF1109 GB:PROTEIN_ID ABE39146.1 GB:DB_XREF GI:91682844 InterPro:IPR009495 LENGTH 212 SQ:AASEQ MDTDQFINTLAVDVGQRERPVGQALAASLLVALPVSAAMLLSTLGLRPDIANAVANPFFDLKFVVTLALALSAIIVALHLSRPEATARGWRLLLLAPLAILGLAIGGEAMLPQRSSMMTRLVGHNSMLCLGAIPVLSLPLLIAALIGLRRGAPSNPTLAGALAGMIAAGFAATLYAMHCVDDSPLFVAAWYTLATAVVAAIGALAGRRLLRY GT:EXON 1|1-212:0| TM:NTM 6 TM:REGION 23->45| TM:REGION 59->81| TM:REGION 88->110| TM:REGION 126->148| TM:REGION 156->178| TM:REGION 185->206| SEG 24->42|alaasllvalpvsaamlls| SEG 67->81|lalalsaiivalhls| SEG 92->107|llllaplailglaigg| SEG 158->174|lagalagmiaagfaatl| SEG 192->210|tlatavvaaigalagrrll| RP:PFM:NREP 1 RP:PFM:REP 44->191|PF06532|8e-13|33.1|148/204|DUF1109| HM:PFM:NREP 1 HM:PFM:REP 10->212|PF06532|1.1e-64|47.8|203/204|DUF1109| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111--11111----------------------1--1-----------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccccccEEEHHHHHHHHHHHHcccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //