[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39147.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:56 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->51 PF05757 * PsbQ 0.00033 40.5 42/203  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39147.1 GT:GENE ABE39147.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2149167..2149337 GB:FROM 2149167 GB:TO 2149337 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE39147.1 GB:DB_XREF GI:91682845 LENGTH 56 SQ:AASEQ MAEDAAVNEHSRRRVIARMAAWAAAYALLLNVIPASALLAAQSPVQLDLTRKRGCR GT:EXON 1|1-56:0| TM:NTM 1 TM:REGION 20->42| SEG 12->27|rrrviarmaawaaaya| HM:PFM:NREP 1 HM:PFM:REP 5->51|PF05757|0.00033|40.5|42/203|PsbQ| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8,55-57| PSIPRED cccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEHHHHccc //