[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39170.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:127 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->73 PF11075 * DUF2780 2.8e-05 23.9 71/163  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39170.1 GT:GENE ABE39170.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2173112..2173495) GB:FROM 2173112 GB:TO 2173495 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39170.1 GB:DB_XREF GI:91682868 LENGTH 127 SQ:AASEQ MDELIERLADKAGLDKAVAGKSVGIILGFLRNEGPQEPVQALIDTIPGAEAAIESANESRGGLSRLMGSNLMGGGVMAMGARLMGLGLGMADIQKLAHELFHIGREKIGPDRMKTIIAETPGLRQFT GT:EXON 1|1-127:0| SEG 71->91|lmgggvmamgarlmglglgma| HM:PFM:NREP 1 HM:PFM:REP 2->73|PF11075|2.8e-05|23.9|71/163|DUF2780| OP:NHOMO 17 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,126-128| PSIPRED cHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccc //