[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39178.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:134 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 49->84 Y1001_RHIME 1e-04 41.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39178.1 GT:GENE ABE39178.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2181120..2181524) GB:FROM 2181120 GB:TO 2181524 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39178.1 GB:DB_XREF GI:91682876 LENGTH 134 SQ:AASEQ MFFLLRLTFWLGLVLVLLPREKTPDSEKLPQIGASEAVSAASAAVSDFSQFCKRQPSACEIGEHAATVIGHRAQEGARKIYKIIIDKRSSDQTGSIDGVEGVDEQLIGYAPRDTLNPDDVKVEWRLRGSETAAN GT:EXON 1|1-134:0| BL:SWS:NREP 1 BL:SWS:REP 49->84|Y1001_RHIME|1e-04|41.7|36/100| TM:NTM 1 TM:REGION 1->19| SEG 2->18|ffllrltfwlglvlvll| SEG 34->46|aseavsaasaavs| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 25-26,31-31,130-135| PSIPRED cHHHHHHHHHHHHHHHHHcccccccHHHccccccHHHHHHHHHHHHHHHHHHHccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHEEEEEEEcccccccc //