[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39187.1
DDBJ      :             protein of unknown function DUF1214
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  57/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
e.65.1
:192 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   92->167 2p3yA PDBj 2e-04 27.6 %
:RPS:SCOP  54->167 2p3yA1  e.65.1.1 * 3e-14 22.8 %
:RPS:PFM   99->167 PF06742 * DUF1214 4e-11 47.8 %
:HMM:PFM   93->170 PF06742 * DUF1214 4.6e-22 41.0 78/87  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39187.1 GT:GENE ABE39187.1 GT:PRODUCT protein of unknown function DUF1214 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2189716..2190294) GB:FROM 2189716 GB:TO 2190294 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF1214 GB:PROTEIN_ID ABE39187.1 GB:DB_XREF GI:91682885 InterPro:IPR010621 LENGTH 192 SQ:AASEQ MRLIFFTLLALIIAAGVGVGATWMTATRGTDFGTLTIGAWTARPRAGTAEIDPYARAAIARSGELPIGAGDGIAFIATADDSKRPLDGRCDVEVSGVTPAARFWTLTLYDPRGYLIANSLERYGFTSQEILRAADGEFKIRVAARSRSGNWLPTGGVDRYMLVLRLYDTPVGVATRTKRDAPMPTIATLGCP GT:EXON 1|1-192:0| TM:NTM 1 TM:REGION 3->25| SEG 3->21|lifftllaliiaagvgvga| BL:PDB:NREP 1 BL:PDB:REP 92->167|2p3yA|2e-04|27.6|76/447| RP:PFM:NREP 1 RP:PFM:REP 99->167|PF06742|4e-11|47.8|69/87|DUF1214| HM:PFM:NREP 1 HM:PFM:REP 93->170|PF06742|4.6e-22|41.0|78/87|DUF1214| RP:SCP:NREP 1 RP:SCP:REP 54->167|2p3yA1|3e-14|22.8|114/461|e.65.1.1| OP:NHOMO 61 OP:NHOMOORG 58 OP:PATTERN -----------------------1-------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111111111-11111111113-11111211111111-11---------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 76 STR:RPRED 39.6 SQ:SECSTR ###########################################################################################EEEcccccEEEEEEEEEEETTTccccccccccEEETTcccccTTccEEEEEcccccTTccccccTTccEEEEEEEE######################### DISOP:02AL 192-193| PSIPRED cEEHHHHHHHHHHHHcccccHHHHHHHHHcccEEEEEcccccccccccccccHHHHHHHHHHccccccHHHEEEEEEEEcccccccccccEEEEccccccccEEEEEEEcccccccccccccccccccccEEcccccEEEEEccccccccEEEccccccEEEEEEEccccHHHHcccEEEcccccEEEcccc //