[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39192.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:98 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   20->79 PF05616 * Neisseria_TspB 0.0001 26.7 60/502  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39192.1 GT:GENE ABE39192.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2197446..2197742 GB:FROM 2197446 GB:TO 2197742 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39192.1 GB:DB_XREF GI:91682890 LENGTH 98 SQ:AASEQ MFALARLAARVAAAAMLSVPAVAQAQTASEAGTAKPKPSAASQAKPATAADPKAAPKKEPKTMTRRQEIEHAIDTRTVPSRYRSSVPKEYQKYIPFAK GT:EXON 1|1-98:0| TM:NTM 1 TM:REGION 3->25| SEG 3->25|alarlaarvaaaamlsvpavaqa| SEG 33->61|takpkpsaasqakpataadpkaapkkepk| HM:PFM:NREP 1 HM:PFM:REP 20->79|PF05616|0.0001|26.7|60/502|Neisseria_TspB| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,4-4,7-7,25-67,98-99| PSIPRED cHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccccccccHHcccccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHcHHHHHHHccccc //