Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39196.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:44 amino acids
:HMM:PFM   9->21 PF02817 * E3_binding 0.00026 61.5 13/39  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39196.1 GT:GENE ABE39196.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2201747..2201881 GB:FROM 2201747 GB:TO 2201881 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE39196.1 GB:DB_XREF GI:91682894 LENGTH 44 SQ:AASEQ MQQIELHPGPFGRLTKGDILASLAMAGIALLLTPVIGLLVLLIV GT:EXON 1|1-44:0| TM:NTM 1 TM:REGION 19->41| SEG 28->43|iallltpvigllvlli| HM:PFM:NREP 1 HM:PFM:REP 9->21|PF02817|0.00026|61.5|13/39|E3_binding| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,6-6| PSIPRED cccEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //