[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39199.1
DDBJ      :             protein of unknown function DUF264
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  55/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:386 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   216->369 3c6aA PDBj 2e-15 13.8 %
:RPS:PFM   21->332 PF03237 * Terminase_6 3e-15 32.2 %
:HMM:PFM   2->370 PF03237 * Terminase_6 3.1e-39 22.6 359/384  
:BLT:SWISS 139->228 HEM3_RHIME 8e-04 31.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39199.1 GT:GENE ABE39199.1 GT:PRODUCT protein of unknown function DUF264 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2203420..2204580 GB:FROM 2203420 GB:TO 2204580 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF264 GB:PROTEIN_ID ABE39199.1 GB:DB_XREF GI:91682897 InterPro:IPR004921 LENGTH 386 SQ:AASEQ MIGGRGAGKTRGGAEWVRCQALGLPPFASVPAARIALVGETEHDVREVMIEGVSGLLAVHPPDQRPNWLPSRKRLEWSNGAVAQAFSADDPESLRGPQFSCAWSDEMAKWRYAEAAFDMLQFGLRLGAQPRQLITTTPRPSTLLKRLLGDPSAVTTRAPTRANALNLAPTFLQAVMARYAGTRLGRQELDGELIEERPDALWSRALIETCRVADAPPLQRLVVAVDPPVSSGKRADCCGIVAAGIAESGVVYVLADDSVAAATPSLWANKAIALWRRLCADALVVEINQGGEMVKTVIGEVDGNVPVTPVRAFRGKWLRAEPVATLYEQGRVKHAGCFAALEDEMCDFGASGLSNGRSPDRLDAMVWAVTTLAFTPRAAEPRIRMF GT:EXON 1|1-386:0| BL:SWS:NREP 1 BL:SWS:REP 139->228|HEM3_RHIME|8e-04|31.5|89/100| SEG 3->14|ggrgagktrgga| RP:PDB:NREP 1 RP:PDB:REP 216->369|3c6aA|2e-15|13.8|145/198| RP:PFM:NREP 1 RP:PFM:REP 21->332|PF03237|3e-15|32.2|292/365|Terminase_6| HM:PFM:NREP 1 HM:PFM:REP 2->370|PF03237|3.1e-39|22.6|359/384|Terminase_6| OP:NHOMO 63 OP:NHOMOORG 56 OP:PATTERN -------------------------------------------------1------------------ ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------211------11---111112211111111111--11-11-11--1--111------1-131-11111111111-----------2----------------------------------12-1----------------------------1-----------------------------------------------------------------------1--------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 145 STR:RPRED 37.6 SQ:SECSTR #######################################################################################################################################################################################################################cTTccEEEEEEc##ccccccccEEEEEEEc#ccccEEEEEEEEEccccTTTHHHHHHHHHHHTTcccEEEcccHHHHHHHHHHcccccTTcccccccHHHHHHHHHHHHHHHHTTcEEccc##HHHHHHHHHcccccccc####HHHHHHHHHH################# DISOP:02AL 1-9,350-358| PSIPRED ccccccccccccHHHHHHHHHHcccccccccccEEEEEEccHHHHHHHEEccccccEEEcccccccccccccEEEEcccccEEEEEccccHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHcccccEEEEEcccHHHcccccHHHHHHHHcccccccHHHHHHcccEEEEccccEEcHHHHHHHHHcccccccEEEEEEcccccccccccEEEEEEEEEcccccEEEEcccccccccHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHcccccEEEEEEccccEEHHHHHHHHHHcccEEEEcccHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccHHccccccccc //