[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39200.1
DDBJ      :             Excinuclease ABC, C subunit-like
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  84/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.226.1
:95 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->77 1ywlA PDBj 1e-05 31.1 %
:RPS:SCOP  7->94 1ln0A  d.226.1.1 * 9e-15 12.5 %
:HMM:SCOP  3->92 1mk0A_ d.226.1.1 * 1e-17 33.7 %
:RPS:PFM   7->69 PF01541 * GIY-YIG 1e-04 37.1 %
:HMM:PFM   7->77 PF01541 * GIY-YIG 6.3e-13 37.1 70/80  
:BLT:SWISS 1->83 Y2523_STAHJ 5e-09 38.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39200.1 GT:GENE ABE39200.1 GT:PRODUCT Excinuclease ABC, C subunit-like GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2204685..2204972) GB:FROM 2204685 GB:TO 2204972 GB:DIRECTION - GB:PRODUCT Excinuclease ABC, C subunit-like GB:PROTEIN_ID ABE39200.1 GB:DB_XREF GI:91682898 InterPro:IPR000305 LENGTH 95 SQ:AASEQ MSRSYDVYILASRYRGTLYVGVTNDLPRRIAEHKAGAADGFTKKYNIKILVHVEEYSSILEARTREHVLKRWRRDWKIALIEKLNPDWRDLSNDL GT:EXON 1|1-95:0| BL:SWS:NREP 1 BL:SWS:REP 1->83|Y2523_STAHJ|5e-09|38.3|81/82| BL:PDB:NREP 1 BL:PDB:REP 3->77|1ywlA|1e-05|31.1|74/96| RP:PFM:NREP 1 RP:PFM:REP 7->69|PF01541|1e-04|37.1|62/80|GIY-YIG| HM:PFM:NREP 1 HM:PFM:REP 7->77|PF01541|6.3e-13|37.1|70/80|GIY-YIG| GO:PFM:NREP 3 GO:PFM GO:0004518|"GO:nuclease activity"|PF01541|IPR000305| GO:PFM GO:0005622|"GO:intracellular"|PF01541|IPR000305| GO:PFM GO:0006281|"GO:DNA repair"|PF01541|IPR000305| RP:SCP:NREP 1 RP:SCP:REP 7->94|1ln0A|9e-15|12.5|88/92|d.226.1.1| HM:SCP:REP 3->92|1mk0A_|1e-17|33.7|86/97|d.226.1.1|1/1|GIY-YIG endonuclease| OP:NHOMO 174 OP:NHOMOORG 84 OP:PATTERN -------------------------------------------------------------------- 1----------------------------------------------------------------------------------------------------111-----1---------------1---11---1-1--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------1--------------------------5332-------323212432-8------------------1-125-1---1-1-11-2-24-6-----------------------1----------------22--41-----1-1--7554-----------------------------------------------------------1-22-22-1-------2-------------------------------------------------------------1---------------2----1------1----------------------------------------------------------------------------------------------411111-B42-------------------------------------------------211-11111-------------11-------------------------------------------------------------1---------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 78 STR:RPRED 82.1 SQ:SECSTR ##ccEEEEEEEcT#TcccEEEEEccHHHHHHHHHHHHcccccccccccEEEEEEEEccHHHHHHHHHHHHHccHHHHHHHH############## DISOP:02AL 1-2| PSIPRED ccccEEEEEEEEccccEEEEEEEccHHHHHHHHHcccccccccccccEEEEEEEEcccHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHccc //