[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39203.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:60 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39203.1 GT:GENE ABE39203.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2206556..2206738 GB:FROM 2206556 GB:TO 2206738 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE39203.1 GB:DB_XREF GI:91682901 LENGTH 60 SQ:AASEQ MDRLHQVLSAIRTETKSAKNPASVFREFLSHVDQAQRKPPAKRPRLKAAAPRRRAAKRTK GT:EXON 1|1-60:0| SEG 35->58|aqrkppakrprlkaaaprrraakr| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,18-18,34-61| PSIPRED cHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccHHHHcHHHHHHHHcc //