[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39205.1
DDBJ      :             phage major capsid protein, HK97
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  114/915 : Eukaryota  0/199 : Viruses  4/175   --->[See Alignment]
d.183.1
:431 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   171->428 3e8kG PDBj 9e-34 16.4 %
:RPS:SCOP  138->428 1ohgA  d.183.1.1 * 9e-33 15.9 %
:HMM:SCOP  135->431 1ohgA_ d.183.1.1 * 5.1e-77 41.8 %
:RPS:PFM   18->74 PF03396 * Pox_RNA_pol_35 2e-04 33.3 %
:RPS:PFM   144->426 PF05065 * Phage_capsid 2e-32 39.6 %
:HMM:PFM   143->428 PF05065 * Phage_capsid 1.1e-74 42.6 263/276  
:HMM:PFM   37->87 PF03954 * Lectin_N 0.00075 20.4 49/138  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39205.1 GT:GENE ABE39205.1 GT:PRODUCT phage major capsid protein, HK97 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2207879..2209174 GB:FROM 2207879 GB:TO 2209174 GB:DIRECTION + GB:PRODUCT phage major capsid protein, HK97 GB:PROTEIN_ID ABE39205.1 GB:DB_XREF GI:91682903 InterPro:IPR006444 LENGTH 431 SQ:AASEQ MNPFFIITTRDHMMTTTFDHAPETKAGIAGDDAQQVYDALMRTFEDYKAENDSRLQAIEKRGGDVIAEDKVARIDAALNAQQRRLDELALKQARPQLGADSALRPRGAAEHKSAFDAYIRNGDAATLRQIETKALSVGSNPDGGYLVPEELERSIAARLSAISPIRGLASVRQISGSVYKKPFMTAGPATGWVGEAAARPQTSSPTLDALSFPAMELYAMPAATATLLDDAAVNLDDWLTGEIDTVFAEQEGAAFVSGDGINKPKGFLAAPTVANAAWSWGNLGFVATGAAGAFPASNPSDVLIDLMFALKPGYRQNASFVMNRRTQAAIRKFKDNNGVYLWQPPATASGRASLIGFPLADAEDMPDIAANSLAIAFGDFRRGYLIVDRQGVRVLRDPYSAKPYVLFYTTKRVGGGVQDFDAIKLLKFGGS GT:EXON 1|1-431:0| SEG 222->232|aatatllddaa| RP:PDB:NREP 1 RP:PDB:REP 171->428|3e8kG|9e-34|16.4|238/247| RP:PFM:NREP 2 RP:PFM:REP 18->74|PF03396|2e-04|33.3|57/291|Pox_RNA_pol_35| RP:PFM:REP 144->426|PF05065|2e-32|39.6|265/271|Phage_capsid| HM:PFM:NREP 2 HM:PFM:REP 143->428|PF05065|1.1e-74|42.6|263/276|Phage_capsid| HM:PFM:REP 37->87|PF03954|0.00075|20.4|49/138|Lectin_N| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF03396|IPR005059| GO:PFM GO:0003899|"GO:DNA-directed RNA polymerase activity"|PF03396|IPR005059| GO:PFM GO:0019083|"GO:viral transcription"|PF03396|IPR005059| RP:SCP:NREP 1 RP:SCP:REP 138->428|1ohgA|9e-33|15.9|270/280|d.183.1.1| HM:SCP:REP 135->431|1ohgA_|5.1e-77|41.8|275/0|d.183.1.1|1/1|Major capsid protein gp5| OP:NHOMO 141 OP:NHOMOORG 118 OP:PATTERN -------------------------------------------------------------------- --------------------------------1----2---------------------------------------------------------------------------------------------------------1--------------------------------------------------------1--1---1-----------------------------------------------------1------------------1-----------------------1-------------------1-------------1-22------1-----2------1----1---------111-----------54211111111-111-11--11-11121111--114------1-121-11112221111----------------111111111111--11--2------1-11-11-1-----------------11-------1-------------1--------------------------1---------------111------------------------1---1--------------------------------------------------2----------------11--1-1-------2-1-1--11-----1--------1---11----------------1------------------------------1--1----------------------------------1---------------------------------1----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------1----------------------------------------------------------------------------------------------1-1-1----------------------- STR:NPRED 261 STR:RPRED 60.6 SQ:SECSTR ###################################################################################################################################################################cHHHHccccccTTGGGcEEEEccccEEEEEEEEcccccccccEEEEEEEEcEEEEEEEEEcTTTTccHHTHHHHHTTTTHHHHHHHHHHHHHHcccccTTccccHHHHcEEccGcccHHHHcEEccGGGccTTccHHHHHHHHHHHHHTTTccccEEEccTTTTHHHHTcEETTTEEcccccTccccccccTTccccccTTccT####cTEEEEEcHHHHcEEEEEEEEEEEEEcccTTTTEEEEEEEEEEEccccGGGEEEEEc### DISOP:02AL 1-1,26-30,55-65,90-109,431-432| PSIPRED cccEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHcccccccccccHHHHHHHHHHHHHcccccccHHHHHHcccccccccccEEccHHHHHHHHHHHHccccHHHEEEEEEcccccEEEEEEcccccEEEEccccccccccccccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEcccccccccccccccEEEccccccccccHHHHHHHHHHHHHcHHHHcccEEEEcHHHHHHHHHHHcccccEEEccccccccccEEcccEEEEEccccccccccEEEEEEEccccEEEEEEcccEEEEcccccccEEEEEEEEEEccEEEccccEEEEEEEcc //