[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39206.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.122.1
:164 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  9->162 1wmmA1 b.122.1.8 * 1.8e-16 21.4 %
:HMM:PFM   49->158 PF01878 * DUF55 4e-06 20.4 98/143  
:BLT:SWISS 26->160 Y474_KORCO 8e-09 38.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39206.1 GT:GENE ABE39206.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2209291..2209785) GB:FROM 2209291 GB:TO 2209785 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE39206.1 GB:DB_XREF GI:91682904 LENGTH 164 SQ:AASEQ MATKQSNDAGFYILTVNDAYSSANVLTKVAAWDIAKGRLDANLWALYDRTRHKNDVKVGDRLLIYIGGTKRARQHFVAKSTVAHIEGPSKLKSATAVGAILGSDVYRVLTLKDTVWIEPVSIRSIFGSLSFLPKHSKWGATLMGGCKSIRREDYEIITNSGFDG GT:EXON 1|1-164:0| BL:SWS:NREP 1 BL:SWS:REP 26->160|Y474_KORCO|8e-09|38.3|120/147| HM:PFM:NREP 1 HM:PFM:REP 49->158|PF01878|4e-06|20.4|98/143|DUF55| HM:SCP:REP 9->162|1wmmA1|1.8e-16|21.4|140/0|b.122.1.8|1/1|PUA domain-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8,164-165| PSIPRED ccccccccccEEEEEEEcccccccEEEcHHHHHHHHHccccHHHHHHHHccccccEEEccEEEEEEcccccccccccccEEEEEEEEcHHccccHHcccccccccEEEEEEEEEEEEccccHHHHccccEEcccccccHHHHHHHHHHcccccEEEEEEccccc //