[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39211.1
DDBJ      :             protein of unknown function DUF264
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  55/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:370 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   185->352 3c6aA PDBj 9e-16 16.4 %
:RPS:PFM   14->316 PF03237 * Terminase_6 6e-15 29.5 %
:HMM:PFM   12->354 PF03237 * Terminase_6 9.5e-39 24.2 335/384  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39211.1 GT:GENE ABE39211.1 GT:PRODUCT protein of unknown function DUF264 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2215477..2216589 GB:FROM 2215477 GB:TO 2216589 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF264 GB:PROTEIN_ID ABE39211.1 GB:DB_XREF GI:91682909 InterPro:IPR004921 LENGTH 370 SQ:AASEQ MRALAHGTPPYAERPHRRIALIGESWQDAREVMVEGESGLLRCSPRAERPEWIASRRRLEWRNGAVGQVFSADDPDGLRGPQFDAAWCDELAKWRYAEACFDTLQFGLRLGLQPRQLVTTTPRPLPLIKRLLADPRTRVTRAPTKANADHLSPAFLDAVVGRYAGTRMGRQELDGELIEDRADALWSRALIETCRVAQPPGLARVVVAIDPPGTSKRGADACGIVAAGRSDSGAYYVLEDASAAGLSPAAWAAKAVAMYRRLDADSLIAEVNMGGEMVRAVLRETDASVPLKEVHATRGKYLRAEPVAALYEQGKVKHVGCFPLLEDEMCDFGIDGLSTNRSPDRLDALVWAITGLMNGRSHGGPKLRQL GT:EXON 1|1-370:0| SEG 241->255|asaaglspaawaaka| RP:PDB:NREP 1 RP:PDB:REP 185->352|3c6aA|9e-16|16.4|159/198| RP:PFM:NREP 1 RP:PFM:REP 14->316|PF03237|6e-15|29.5|292/365|Terminase_6| HM:PFM:NREP 1 HM:PFM:REP 12->354|PF03237|9.5e-39|24.2|335/384|Terminase_6| OP:NHOMO 63 OP:NHOMOORG 56 OP:PATTERN -------------------------------------------------1------------------ ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------211------11---111112211111111111--11-11-11--1--111------1-131-11111111111-----------2----------------------------------12-1----------------------------1-----------------------------------------------------------------------1--------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 159 STR:RPRED 43.0 SQ:SECSTR ########################################################################################################################################################################################HHHcccccccccccccTTccEEEEEEcccc##cccccEEEEEEEc#ccccEEEEEEEEEccccTTTHHHHHHHHHHHTTcccEEEcccHHHHHHHHHHHHcccTTcccccccHHHHHHHHHHHHHHHHTTcEEccc##HHHHHHHHHcccccc####ccHHHHHHHHH################## DISOP:02AL 1-8,335-342| PSIPRED cccccccccccccccccEEEEEEccHHHHHHHEEEccccEEEccccccccccccccEEEEEccccEEEEEccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHccccEEEEEcccHHHHHcccHHHHHHHHHHHccHHHHHHHHccEEHHHcccccccHHHHHHHHHHccccccEEEEEEcccccccccccEEEEEEEEEcccccEEEEEccccccccHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHcccccEEEEEEcccccccccHHHHHHHcccEEEccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccccccEEEcc //