[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39215.1
DDBJ      :             Phage conserved hypothetical protein, phiE125 gp8
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:189 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   141->187 PF05135 * Phage_QLRG 4e-04 42.2 %
:HMM:PFM   16->53 PF05135 * Phage_QLRG 4.2e-06 36.8 38/102  
:HMM:PFM   140->185 PF05135 * Phage_QLRG 2.5e-06 42.2 45/102  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39215.1 GT:GENE ABE39215.1 GT:PRODUCT Phage conserved hypothetical protein, phiE125 gp8 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2218591..2219160 GB:FROM 2218591 GB:TO 2219160 GB:DIRECTION + GB:PRODUCT Phage conserved hypothetical protein, phiE125 gp8 GB:PROTEIN_ID ABE39215.1 GB:DB_XREF GI:91682913 InterPro:IPR011738 LENGTH 189 SQ:AASEQ MSAMLLAGPAVEPWTVAELKAFLRVAHDDDDAVIAALLAAARGQIEAMTRRALLAQSWRVLRDGWPDDGRIALRIGPLRSLTAAVVFDAQGVAHPIGLDCFVIDTANGVIAAPAWSLPRPGRSLAGIALDVELGFGAVGSDVPELLRHAVRTLVAHWYENRGLAAIGTSVAMLPGSVAAMIASFRVLSL GT:EXON 1|1-189:0| SEG 25->41|vahddddaviaallaaa| RP:PFM:NREP 1 RP:PFM:REP 141->187|PF05135|4e-04|42.2|45/91|Phage_QLRG| HM:PFM:NREP 2 HM:PFM:REP 16->53|PF05135|4.2e-06|36.8|38/102|Phage_QLRG| HM:PFM:REP 140->185|PF05135|2.5e-06|42.2|45/102|Phage_QLRG| OP:NHOMO 23 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111-111111------------1----1--------11--1-------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cccccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEccccccccEEEcccccEEEEEEEEEEccccEEcccccccccccccccEEcccccccccccccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHccccc //