[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39220.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:65 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->61 PF09550 * DUF2376 4.7e-22 55.8 43/43  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39220.1 GT:GENE ABE39220.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2220710..2220907 GB:FROM 2220710 GB:TO 2220907 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39220.1 GB:DB_XREF GI:91682918 InterPro:IPR011739 LENGTH 65 SQ:AASEQ MTPFPWSEAMQFGFGVLRLSSDQFWRMTPRELASAIVAVRGRVVAPLDRGELDDLLRRYPDQRGG GT:EXON 1|1-65:0| SEG 47->58|ldrgelddllrr| HM:PFM:NREP 1 HM:PFM:REP 17->61|PF09550|4.7e-22|55.8|43/43|DUF2376| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,61-66| PSIPRED cccccHHHHHHHcccEEEEcHHHHccccHHHHHHHHHHHcccEEEEccHHHHHHHHHHccccccc //