[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39224.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  131/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:226 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->214 1t33B PDBj 3e-18 28.3 %
:RPS:PDB   17->213 3bt9B PDBj 4e-15 8.9 %
:RPS:SCOP  13->81 2fbqA1  a.4.1.9 * 1e-15 34.8 %
:RPS:SCOP  104->189 1t33A2  a.121.1.1 * 1e-07 29.1 %
:HMM:SCOP  13->91 2fbqA1 a.4.1.9 * 3.5e-15 35.4 %
:HMM:SCOP  94->226 1t33A2 a.121.1.1 * 5e-18 28.8 %
:RPS:PFM   21->67 PF00440 * TetR_N 2e-05 38.3 %
:RPS:PFM   102->195 PF09209 * DUF1956 2e-12 34.0 %
:HMM:PFM   102->219 PF09209 * DUF1956 5.9e-33 35.6 118/125  
:HMM:PFM   21->67 PF00440 * TetR_N 1.1e-14 38.3 47/47  
:BLT:SWISS 29->214 YBIH_SHIFL 4e-11 25.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39224.1 GT:GENE ABE39224.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2223929..2224609 GB:FROM 2223929 GB:TO 2224609 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE39224.1 GB:DB_XREF GI:91682922 InterPro:IPR001647 LENGTH 226 SQ:AASEQ MKISSGIEIQNKSSEATRERLIEAGLKLFAELGMDGVRTRALAEVAGVNQSAIPYHFGSKDGVYRAVIEEIAREIADGLAATGLLQMSAAEGKTMSRDRCLKNLRALIRAFTILILSPGRSTDRTLLIVREQLRPTENFNHLFKSFIEPIHKTVGSIVARLNDDRADSEVTIIRAHAIIGQVLSFAVAQHSYLMRSKNSKLSLDKVEEIADVISEMAVVSADFSGR GT:EXON 1|1-226:0| BL:SWS:NREP 1 BL:SWS:REP 29->214|YBIH_SHIFL|4e-11|25.6|180/223| BL:PDB:NREP 1 BL:PDB:REP 15->214|1t33B|3e-18|28.3|198/214| RP:PDB:NREP 1 RP:PDB:REP 17->213|3bt9B|4e-15|8.9|179/186| RP:PFM:NREP 2 RP:PFM:REP 21->67|PF00440|2e-05|38.3|47/47|TetR_N| RP:PFM:REP 102->195|PF09209|2e-12|34.0|94/125|DUF1956| HM:PFM:NREP 2 HM:PFM:REP 102->219|PF09209|5.9e-33|35.6|118/125|DUF1956| HM:PFM:REP 21->67|PF00440|1.1e-14|38.3|47/47|TetR_N| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00440|IPR001647| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00440|IPR001647| RP:SCP:NREP 2 RP:SCP:REP 13->81|2fbqA1|1e-15|34.8|69/79|a.4.1.9| RP:SCP:REP 104->189|1t33A2|1e-07|29.1|86/132|a.121.1.1| HM:SCP:REP 13->91|2fbqA1|3.5e-15|35.4|79/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 94->226|1t33A2|5e-18|28.8|132/132|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 143 OP:NHOMOORG 131 OP:PATTERN -------------------------------------------------------------------- --------------1----------------------311-----------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1121-11111111111---------2-------11111111---1---1----------------------1----------------------------------------1121121----11-1------1-----1--------------1-1----------------------1-1-----11--1----1-1--------1-5-----------------------------1----------------------------------------11--11-1111111111-1111111111111111111111--112111111111111111111111111--1--1111--111-------------------------------------------1----1-2------------------------------------1----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 214 STR:RPRED 94.7 SQ:SECSTR ###HHHHHHcccccTTcHHHHHHHHHHHHHHcccccccHHHHHHHHTccTTcTTcccccHHHHHHHHHHHHHHHHHHHHHHHGGGcccHHHTccHHHHHHHTHHHHHHHHHHHccccGGGTHHHHHHHHHTcccccccTTTTHHHHHHHHHHHHHHHHHHHHHHTccccccHHHHHHHHHHHHHHHHHHHHHTTTTccHHHHHHHHHHHHHHHHHHH######### DISOP:02AL 1-21,225-227| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccc //