[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39237.1
DDBJ      :             CcmE/CycJ protein
Swiss-Prot:CCME_RHOPS   RecName: Full=Cytochrome c-type biogenesis protein ccmE;AltName: Full=Cytochrome c maturation protein E;AltName: Full=Heme chaperone ccmE;

Homologs  Archaea  0/68 : Bacteria  335/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
b.40.9
:164 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   29->135 1lizA PDBj 8e-22 47.7 %
:RPS:SCOP  32->122 1j6qA  b.40.9.1 * 6e-15 42.9 %
:HMM:SCOP  29->135 1sr3A_ b.40.9.1 * 2.6e-36 57.0 %
:RPS:PFM   3->128 PF03100 * CcmE 1e-30 50.0 %
:HMM:PFM   1->130 PF03100 * CcmE 5.9e-51 56.9 130/131  
:BLT:SWISS 1->148 CCME_RHOPS 7e-72 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39237.1 GT:GENE ABE39237.1 GT:PRODUCT CcmE/CycJ protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2239710..2240204 GB:FROM 2239710 GB:TO 2240204 GB:DIRECTION + GB:PRODUCT CcmE/CycJ protein GB:PROTEIN_ID ABE39237.1 GB:DB_XREF GI:91682935 InterPro:IPR004329 LENGTH 164 SQ:AASEQ MTRKQRRLLMIGGAGVVLVVAVGLVLNAMRGSIVFFSTPKMVSEQQIGAGTRFRLGGVVEPGSLHRGDQLAVSFKVSDGAATVPVAFKGILPDLFREGQGVIAEGALDTAGVFKADTVLAKHDETYMPKEVADALKKQGHWKDDYEKKPPGAPGASADAAGPSR GT:EXON 1|1-164:0| SW:ID CCME_RHOPS SW:DE RecName: Full=Cytochrome c-type biogenesis protein ccmE;AltName: Full=Cytochrome c maturation protein E;AltName: Full=Heme chaperone ccmE; SW:GN Name=ccmE; Synonyms=cycJ; OrderedLocusNames=RPD_2002; SW:KW Cell inner membrane; Cell membrane; Complete proteome;Cytochrome c-type biogenesis; Heme; Iron; Membrane; Metal-binding;Signal-anchor; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->148|CCME_RHOPS|7e-72|100.0|148/164| GO:SWS:NREP 6 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0017004|"GO:cytochrome complex assembly"|Cytochrome c-type biogenesis| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| SEG 12->26|ggagvvlvvavglvl| SEG 149->163|ppgapgasadaagps| BL:PDB:NREP 1 BL:PDB:REP 29->135|1lizA|8e-22|47.7|107/114| RP:PFM:NREP 1 RP:PFM:REP 3->128|PF03100|1e-30|50.0|126/131|CcmE| HM:PFM:NREP 1 HM:PFM:REP 1->130|PF03100|5.9e-51|56.9|130/131|CcmE| GO:PFM:NREP 3 GO:PFM GO:0005886|"GO:plasma membrane"|PF03100|IPR004329| GO:PFM GO:0017003|"GO:protein-heme linkage"|PF03100|IPR004329| GO:PFM GO:0017004|"GO:cytochrome complex assembly"|PF03100|IPR004329| RP:SCP:NREP 1 RP:SCP:REP 32->122|1j6qA|6e-15|42.9|91/100|b.40.9.1| HM:SCP:REP 29->135|1sr3A_|2.6e-36|57.0|107/0|b.40.9.1|1/1|Heme chaperone CcmE| OP:NHOMO 377 OP:NHOMOORG 343 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------11-11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--111111111111111111111111111111111-11111111111-111121121111111111211111112111111111111111111111111--1111111111111111111111111-11-1-----------------------111221111-11----1-1---11-----1-------121111----------------------------1------------------------------11-111111111111111111111111111---111-------11--1-11111111111-111111111111111111111111---222222222222222211111111--111111111111---1-----1111111-1111111111111111-------1111111111121111111111----------1111111111111111222222231111111-------------------------------------------------------- -----------------------------------------------------------------------------------------------------------1-1-----------------------------------------------------------------1---------1112-1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 107 STR:RPRED 65.2 SQ:SECSTR ############################ccccccccccTcTTTcccccTTcEEEEEEEEcTTTcEEccccEEEEEEEccccEEEEEEEccccTTccTTcEEEEEEEEccccEEEEcccccccccccccHHHHTcc############################# DISOP:02AL 1-3,132-165| PSIPRED ccccccEEEEEcccHHHHHHHHHHHHHHHHHcHHHcccHHHHHccccccccEEEEEEEEEccEEEEccccEEEEEEEccccEEEEEEEEccccccccccEEEEEEEEccccEEEEEEEEEEcccccccHHHHHHHHHccccccccccccccccccccccccccc //