[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39242.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:216 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   50->111 PF01565 * FAD_binding_4 0.00033 22.6 62/138  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39242.1 GT:GENE ABE39242.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2246081..2246731) GB:FROM 2246081 GB:TO 2246731 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE39242.1 GB:DB_XREF GI:91682940 LENGTH 216 SQ:AASEQ MLTSRHLIVTTMLLGLAVGSASAGDAERKLTFPQGATATKVAGKISGRNGVNHLVAAGAGQTMQVLFAPSNRSCYFNVFEPGAAEAAHIGSTAGNEFGVERTTAGTYRVQVYLMRNAARRNEVCRYQLSVELTGAPGGVSAGVSDRIKQDVCKAEAAGMYGVDQRRIAVGPVRTSPRGSEIDGTADKQADGIKKLRCIFKADGSFDHIMAMTPDGE GT:EXON 1|1-216:0| HM:PFM:NREP 1 HM:PFM:REP 50->111|PF01565|0.00033|22.6|62/138|FAD_binding_4| OP:NHOMO 16 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------22-----------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------1-11------------------------------------------------------1--------------------------------------------------1-----1------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,179-183,214-217| PSIPRED ccccHHHHHHHHHHHHHHHccccccEEEEEEEcccccccEEEEEEEEcccEEEEEEcccccEEEEEEccccccEEEEEcccccHHHHccccccccccEEEEEcccEEEEEEEEEEcHHHcccEEEEEEEEEEEcccccccccHHHHHHHHHHHHHcccccccccEEEEEcccccccccccccccccccccccEEEEEEEEccccEEEEEEEccccc //