[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39243.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:163 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   28->63 PF12464 * Mac 0.00096 34.3 35/55  
:HMM:PFM   113->163 PF02387 * IncFII_repA 0.00066 34.7 49/281  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39243.1 GT:GENE ABE39243.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2247133..2247624 GB:FROM 2247133 GB:TO 2247624 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39243.1 GB:DB_XREF GI:91682941 LENGTH 163 SQ:AASEQ MMQDLLASAGVAVAAWFAVYFVGKPVVALQETRLEALKVAERYYNVDMSASEDERDAALKALFEVGTALRTLHRGWSTAVRLWCWVWRYDLDLAAQAVFGLAEGPRGKISIAPEIRKNTLDALYVALGAHKHLSSETVQAIRRMIAQTQAAGRQTTSASGSLS GT:EXON 1|1-163:0| TM:NTM 1 TM:REGION 5->27| SEG 7->23|asagvavaawfavyfvg| HM:PFM:NREP 2 HM:PFM:REP 28->63|PF12464|0.00096|34.3|35/55|Mac| HM:PFM:REP 113->163|PF02387|0.00066|34.7|49/281|IncFII_repA| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,151-164| PSIPRED cHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccEEEEcHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccc //