[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39250.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:96 amino acids
:PSIPRED
:DISOPRED
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39250.1 GT:GENE ABE39250.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2256448..2256738) GB:FROM 2256448 GB:TO 2256738 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39250.1 GB:DB_XREF GI:91682948 LENGTH 96 SQ:AASEQ MNFSALFHQFATWSFRAAILGGLLGVVYLAMRGDADMPGARLVASQAGTPNTQVGDFAPCQPIGQTADGELVYSMDCEQTPAEPVADTPASATSAK GT:EXON 1|1-96:0| TM:NTM 1 TM:REGION 11->33| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,37-47,49-50,89-97| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEcccccccccHHHHHccccccccccccccccccccccccEEEEEEHHHccccccccccccccccc //