[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39259.1
DDBJ      :             protein of unknown function DUF112, transmembrane
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  214/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:510 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   45->439 PF01970 * TctA 1e-86 50.4 %
:HMM:PFM   19->439 PF01970 * TctA 2.3e-148 50.7 416/419  
:BLT:SWISS 1->487 YZ2R_AGRVI 1e-69 33.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39259.1 GT:GENE ABE39259.1 GT:PRODUCT protein of unknown function DUF112, transmembrane GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2270234..2271766) GB:FROM 2270234 GB:TO 2271766 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF112, transmembrane GB:PROTEIN_ID ABE39259.1 GB:DB_XREF GI:91682957 InterPro:IPR001991 InterPro:IPR002823 LENGTH 510 SQ:AASEQ MEELANLFHGFAVALMPFNILVMVIGIVLGVIIGVLPGLGGANGVAILLPLTFSMPPTSAIIMLSCIYWGALFGGAITSILFNIPGEPWSVATTFDGYPMAQQGKAGEALTAAFTSSFVGALFAIVMITLVAPLVARFALEFGPPEKFAVYFLAFCSFVGLSKEPPFKTVAAMMLGFALAAVGLDSMTGQLRLTFGFTEMLNGFDFLIAVIGLFGIGEILLTMEDGLSFRGSKAKINLRVVLQTWKELPRYWMTSLRSSVIGCWMGITPAGATPASFMSYGIAKRMSKNGQNFGRGEIEGVIAPETAAHAAGTAALLPMLSLGVPGSPTAAVLLGGLLIWGLQPGPMLFVEQKEFVWGLIASMYLGNVVGLLIVLTCVPVFAAILRIPFSIVAPLILVLCAIGAYSVHNSTFDVMLMLVFGVIGYLLKKCNYPLAPLVLAIVLGDKAEEAFRQSLLASQGALGVFFSNGLVGTIMALGLIALFWSLINEGYVRLRSAATGRPRAAGPDYE GT:EXON 1|1-510:0| BL:SWS:NREP 1 BL:SWS:REP 1->487|YZ2R_AGRVI|1e-69|33.8|482/502| TM:NTM 13 TM:REGION 5->27| TM:REGION 32->53| TM:REGION 61->83| TM:REGION 116->138| TM:REGION 142->164| TM:REGION 167->189| TM:REGION 200->222| TM:REGION 260->282| TM:REGION 318->340| TM:REGION 355->377| TM:REGION 383->405| TM:REGION 407->427| TM:REGION 464->486| SEG 20->41|ilvmvigivlgviigvlpglgg| SEG 303->318|apetaahaagtaallp| RP:PFM:NREP 1 RP:PFM:REP 45->439|PF01970|1e-86|50.4|393/420|TctA| HM:PFM:NREP 1 HM:PFM:REP 19->439|PF01970|2.3e-148|50.7|416/419|TctA| OP:NHOMO 438 OP:NHOMOORG 215 OP:PATTERN -------------------------------------------------------------------- --------111----------1---2------1111--12----1-------132-1-------212-111-----------2-----------------------------------------------------111--------------------------------------------31---11-------------------6111-------114--------3--------------------------------------------------------------------------------------------4---------------------1----1----55-----1-------1---------------733--822232----------4-21111---D---133222832254221--7653-46425--------------1------------------------------1-----24425-----------------------54455111112242232418336------------------1----12-1-1----2----------1111----1--------1-----------------11--1-----1-1111----11---------------------1111------1-111-------111-1--1-11-113-----11211111111111111111------------------------------------189---1-2--------1--------1-2-222212112111111-1----------1-121111111112-----------------1------------------------------------------------3------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 224-243,286-292,494-511| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHcccccHHHHHHHHHccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEcccccccHHHHHHccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHcccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccHHHcccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccccc //