[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39272.1
DDBJ      :             secretion protein HlyD
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  393/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.3.1d.41.2f.46.1
:363 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   49->273 3fppB PDBj 1e-07 25.6 %
:RPS:PDB   28->95 3bg5A PDBj 3e-09 16.7 %
:RPS:PDB   127->229 3bg5D PDBj 7e-05 9.7 %
:RPS:SCOP  54->96 1qpnA2  d.41.2.1 * 6e-07 20.9 %
:RPS:SCOP  123->352 1iu4A  d.3.1.8 * 5e-24 9.1 %
:HMM:SCOP  49->284 1vf7A_ f.46.1.1 * 5.8e-23 27.5 %
:RPS:PFM   65->225 PF00529 * HlyD 9e-08 32.3 %
:HMM:PFM   65->195 PF00529 * HlyD 3e-21 39.7 131/306  
:BLT:SWISS 21->363 MDTE_ECOLI 8e-23 25.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39272.1 GT:GENE ABE39272.1 GT:PRODUCT secretion protein HlyD GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2283664..2284755 GB:FROM 2283664 GB:TO 2284755 GB:DIRECTION + GB:PRODUCT secretion protein HlyD GB:PROTEIN_ID ABE39272.1 GB:DB_XREF GI:91682970 InterPro:IPR006143 LENGTH 363 SQ:AASEQ MSRSLMLPSLRNVLWLPVCVVLAGCSEEAPQNRPAALVKTELVRLQPRQTVIRLTGDVQARVSTELSFRVSGRVIERLVDVGAHVKAGDVLARIDPTEQRADLVGAQAAVAAAEAQLRLAKATFERQKSLMASGFTTRVAFDQAQEGLRTAEGSLDTAKAQLGIATDALSYTELRASAAGIITARNIEVGQVAQSAQSAYTLAEDNARDAVFDVNESIFLTPLEGSTVKLTMVSDPSISAIARPREISPTVDQKSGAVRVKLSIENPPAAMTLGSIVTGEGRGRPVDKIVLPWSALNANLTGPAVWVVDPKTRAVALKNVVIESYETNSIVVGGGLTAGERVVVDGGKLLRPAQIVTYDGENS GT:EXON 1|1-363:0| BL:SWS:NREP 1 BL:SWS:REP 21->363|MDTE_ECOLI|8e-23|25.4|343/385| TM:NTM 1 TM:REGION 9->30| SEG 100->122|radlvgaqaavaaaeaqlrlaka| BL:PDB:NREP 1 BL:PDB:REP 49->273|3fppB|1e-07|25.6|223/267| RP:PDB:NREP 2 RP:PDB:REP 28->95|3bg5A|3e-09|16.7|66/1137| RP:PDB:REP 127->229|3bg5D|7e-05|9.7|103/1067| RP:PFM:NREP 1 RP:PFM:REP 65->225|PF00529|9e-08|32.3|161/259|HlyD| HM:PFM:NREP 1 HM:PFM:REP 65->195|PF00529|3e-21|39.7|131/306|HlyD| GO:PFM:NREP 3 GO:PFM GO:0008565|"GO:protein transporter activity"|PF00529|IPR006143| GO:PFM GO:0009306|"GO:protein secretion"|PF00529|IPR006143| GO:PFM GO:0016020|"GO:membrane"|PF00529|IPR006143| RP:SCP:NREP 2 RP:SCP:REP 54->96|1qpnA2|6e-07|20.9|43/115|d.41.2.1| RP:SCP:REP 123->352|1iu4A|5e-24|9.1|230/331|d.3.1.8| HM:SCP:REP 49->284|1vf7A_|5.8e-23|27.5|222/237|f.46.1.1|1/1|HlyD-like secretion proteins| OP:NHOMO 1206 OP:NHOMOORG 395 OP:PATTERN -------------------------------------------------------------------- 142-----------------------------------------------------------------------------------1--124-311----11---62314--------------1--1-1-----1--------------11---11------1--1-----------------------1-------------------------------------------------------------------------------------------------------------------------------------1--1---------------------------11-111------------22-222----1-35A5A2-29A79523332322334-78576785-81-98865576575579132-23-1-----11111111-11--331---------------1---------------221-344249AA7974211-33672233135483654--33512211445342123151413-------233333--411221232221-222112412---111-221-1-----------------3-----23137-233115345431475435456442---1--1------33341423444344433-4333445343443223223585232121322112122211121433121221-533333323333--1-11-12121112311111-1------1---3332322---124554777546665278911-1-11-1-4434222222626634525221113222---------------------------------------------------------3- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 249 STR:RPRED 68.6 SQ:SECSTR ########################HHHEccccccEEEEEEcccTTcEEcTTcEEEEEEccccEEEEEccccEEccEEcccTTcEEcTTcEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEccccTTcEEEEEEEETTEEEEEEEEcccccccccccccEEEcccccEEEEEcccccEEccTTcccEEEEccccEEEEccccccEEcEEcTTccccEcETTcccccEEEcccccccccEEccccEEEcccEEcccccccT########################################################################################## DISOP:02AL 1-6,24-39,358-364| PSIPRED cccccHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEEEccEEEEEEEEEEEEEEEEEEEEccccEEEEEEcccccEEEcccEEEEEccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccEEEEEEEEccccccccccEEEEEEEcccEEEEEEEcHHHHHHcccccEEEEEEccccccEEEEEEEEEEcccccccEEEEEEEEEEccccccccccEEEEEEEEccccEEEEcHHHEEEcccccEEEEEEccccEEEEEEEEEEEEEccEEEEEEccccccEEEEccHHHcccccEEEEccccc //