[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39277.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:204 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   133->169 PF03413 * PepSY 0.00069 32.4 37/64  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39277.1 GT:GENE ABE39277.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2290458..2291072 GB:FROM 2290458 GB:TO 2291072 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39277.1 GB:DB_XREF GI:91682975 LENGTH 204 SQ:AASEQ MSVRMALTALTTALLLLGQASVVHSALELPDAIEDPAGTSNQEQAGPIVGSGADIVRIVEKNLIGFRVYDLSFNGDGAAPSFDVKSYRGDRIWNTVVDATTRQIVRSAMVMSTSDLHGEDRRNIDDFKRSRMALSEAIAIAEKYGPGNAISAGLHHAGGRLVFVVVVVSNGELKEIVIRADRDKRGRRLDTENPVSDGALRAPA GT:EXON 1|1-204:0| SEG 6->17|altalttallll| SEG 162->168|vfvvvvv| HM:PFM:NREP 1 HM:PFM:REP 133->169|PF03413|0.00069|32.4|37/64|PepSY| OP:NHOMO 12 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------222---21111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,5-5,34-46,109-115,185-185,188-188,199-199,203-205| PSIPRED ccHHHHHHHHHHHHHHHccHHHHHcccccHHHHHHccccHHHcccccEEEEHHHHHHHHHHccccEEEEEEEEEcccccEEEEEEEEcccEEEEEEEEHHHHHHHHHHHHccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccEEEEEEEEEEcccEEEEEEEccccHHHcccccccccccccccccc //