[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39294.1
DDBJ      :             diacylglycerol kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:120 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->113 PF01219 * DAGK_prokar 1.3e-32 35.6 101/104  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39294.1 GT:GENE ABE39294.1 GT:PRODUCT diacylglycerol kinase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2308033..2308395 GB:FROM 2308033 GB:TO 2308395 GB:DIRECTION + GB:PRODUCT diacylglycerol kinase GB:PROTEIN_ID ABE39294.1 GB:DB_XREF GI:91682992 InterPro:IPR000829 LENGTH 120 SQ:AASEQ MRPLLRFWRATINSRNGLAFAIRSEQAIREELIALALAVPAAWLIGITTMRRVELVAVVVLVLVVELLNTAIEKLADRLTTEHDPQIGRVKDMGSAAVGVALAMAGVFWLFALGERMGVF GT:EXON 1|1-120:0| TM:NTM 3 TM:REGION 24->46| TM:REGION 53->75| TM:REGION 95->117| SEG 27->38|aireelialala| SEG 53->68|velvavvvlvlvvell| SEG 94->107|gsaavgvalamagv| HM:PFM:NREP 1 HM:PFM:REP 13->113|PF01219|1.3e-32|35.6|101/104|DAGK_prokar| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111--11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //