[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39313.1
DDBJ      :             MotA/TolQ/ExbB proton channel
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  314/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:257 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   106->205 PF01618 * MotA_ExbB 4e-08 37.4 %
:HMM:PFM   101->209 PF01618 * MotA_ExbB 2.9e-17 25.9 108/139  
:BLT:SWISS 1->248 POMA_VIBAL 2e-53 41.3 %
:PROS 183->200|PS01307|MOTA
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39313.1 GT:GENE ABE39313.1 GT:PRODUCT MotA/TolQ/ExbB proton channel GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2328197..2328970 GB:FROM 2328197 GB:TO 2328970 GB:DIRECTION + GB:PRODUCT MotA/TolQ/ExbB proton channel GB:PROTEIN_ID ABE39313.1 GB:DB_XREF GI:91683011 InterPro:IPR000540 InterPro:IPR002898 LENGTH 257 SQ:AASEQ MDIATLIGLVAGVIVVSTLILMGGNFGMFYDIHAVIIIFGGSFAATLIRFPLSAMLHGLPLGAKFAFTMSSLSARDLVDELARIAEIARKSGPVGLEKVETDEPFLAKGIRYVADGYDLEFIRDNLERDRDNFLLHLNEGSKIYRAIGDCAPAFGMIGTLLGMVQMFSNMSDPSKLGPFMAVALLATLYGAVVANLICLPIADKLHGKLVDEETNRTLIIDGILMIRDSKSPTLVREMLLAYLPEKHRHEEGESVPA GT:EXON 1|1-257:0| BL:SWS:NREP 1 BL:SWS:REP 1->248|POMA_VIBAL|2e-53|41.3|247/253| PROS 183->200|PS01307|MOTA|PDOC01011| TM:NTM 4 TM:REGION 1->23| TM:REGION 26->48| TM:REGION 150->172| TM:REGION 179->201| RP:PFM:NREP 1 RP:PFM:REP 106->205|PF01618|4e-08|37.4|99/132|MotA_ExbB| HM:PFM:NREP 1 HM:PFM:REP 101->209|PF01618|2.9e-17|25.9|108/139|MotA_ExbB| GO:PFM:NREP 3 GO:PFM GO:0006810|"GO:transport"|PF01618|IPR002898| GO:PFM GO:0008565|"GO:protein transporter activity"|PF01618|IPR002898| GO:PFM GO:0016020|"GO:membrane"|PF01618|IPR002898| OP:NHOMO 401 OP:NHOMOORG 314 OP:PATTERN -------------------------------------------------------------------- 1111------------------------------------1---1---1--1-1--------1-1------------------11111--------------------1------------------------------------1---------------------------------------------112222122222222222112212222111121111111111------------------------------------------------------------------------------------------12122222222222212111---111--11111211211111311111---11-----------11111111111------------1111111-------------------------1111----------------122--------------------------------1-1----11111111----111-------111--------------------11121111----------1111213-1123-25333111111111111-1-----111-11111-1111111111111---33-1322112-1111111111111211111---1222--------------------------------------------------------------------------------------------------1111--412-------------------------1111111111211112111---------3111111111111111111111111------112222221111111111--------------------------1-11111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 248-254,257-258| PSIPRED cHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHcccccc //