[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39317.1
DDBJ      :             extracellular solute-binding protein, family 1
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  538/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:370 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->369 1a99A PDBj e-108 52.4 %
:RPS:PDB   30->369 1a99A PDBj 2e-56 52.1 %
:RPS:SCOP  30->369 1a99A  c.94.1.1 * 4e-57 51.8 %
:HMM:SCOP  30->369 1a99A_ c.94.1.1 * 5.1e-96 36.2 %
:RPS:PFM   43->306 PF01547 * SBP_bac_1 3e-09 33.3 %
:HMM:PFM   46->303 PF01547 * SBP_bac_1 3.1e-17 19.3 249/314  
:BLT:SWISS 11->370 POTF_ECOLI e-108 51.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39317.1 GT:GENE ABE39317.1 GT:PRODUCT extracellular solute-binding protein, family 1 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2331650..2332762 GB:FROM 2331650 GB:TO 2332762 GB:DIRECTION + GB:PRODUCT extracellular solute-binding protein, family 1 GB:PROTEIN_ID ABE39317.1 GB:DB_XREF GI:91683015 InterPro:IPR001188 InterPro:IPR006059 LENGTH 370 SQ:AASEQ MRENCYRRLRLGGAAIVLIAGLNAPALAQERVVNFYNWSNYVAPGVLEEFTRETGIKVVYDTFDGNETLEAKLLAGKSGYDVVVPTAYFLQRQIGAKVFQKLDASKLPNLKNAWDVVTKKLALYDPGNQYAANYMWGTTGIGYNVAAVKKIFGPDAVIDSWDIVFKPENLAKLKDCGVQMLDSADDILPAALTHLGLDPNSTKQPDLEKAADVVAKVRPSVRKFHSSEYLNALATGEICLVVGWSGDIKQAQSRAAEAKNGVDIRYAIPKEGAQMFFDNLVIPADAKNVAEAHELINFLYRPDIAARNSDFLSYANGNKASQEFVNARVLSDKTIYPDEAMQARLFVITARDPAIQRSINRLWTRVKTGR GT:EXON 1|1-370:0| BL:SWS:NREP 1 BL:SWS:REP 11->370|POTF_ECOLI|e-108|51.3|357/370| BL:PDB:NREP 1 BL:PDB:REP 30->369|1a99A|e-108|52.4|340/341| RP:PDB:NREP 1 RP:PDB:REP 30->369|1a99A|2e-56|52.1|340/341| RP:PFM:NREP 1 RP:PFM:REP 43->306|PF01547|3e-09|33.3|255/282|SBP_bac_1| HM:PFM:NREP 1 HM:PFM:REP 46->303|PF01547|3.1e-17|19.3|249/314|SBP_bac_1| GO:PFM:NREP 2 GO:PFM GO:0005215|"GO:transporter activity"|PF01547|IPR006059| GO:PFM GO:0006810|"GO:transport"|PF01547|IPR006059| RP:SCP:NREP 1 RP:SCP:REP 30->369|1a99A|4e-57|51.8|340/341|c.94.1.1| HM:SCP:REP 30->369|1a99A_|5.1e-96|36.2|340/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 938 OP:NHOMOORG 554 OP:PATTERN 11--------------1-11111-----1--------------------------------------- --1-2----------------1---2------1111----11-1------------------1-1--2221-----------1-----1111-1------------------------------1-----------44411---12--2---111---------1-12223--------------111----1-111111111111111--111-111111111111111121111111111111111111111111111-11111111111-11111111111111111111111111111111111111111111121111--111111111111111--11111-1111111-11-------------1----1111------11111111111111111111113-1111-1113B1-32231152424523----2-212252311111111111--211---------------------------------1-11111222423122322252444524723--11-----21----221-4111----433333333111-1-1-4--131--21111--------------2-----------------------------222-313---11111111111111121131------1------23111312222222223-222222222222222222322222--12222222222222222122222221-111111111111---------11111-512111222222222223--------111-9988ABC7699873333111111111-222244444233331111111----------1------11111111-12111----------------------1--111-111-2- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-------------------1--112-1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 362 STR:RPRED 97.8 SQ:SECSTR ########cccHHHHccTTcEEEEEccccccEEEEEEETTcccTTHHHHHHHHHccEEEEEEEccHHHHHHHHHHccccccEEcccHHHHHHHHHTTccccccGGGcGGGGGccHHHHHHHHTTcGGGccEEEEEEEEEEEEEEHHHHHHHHcTTccTTcTHHHHcHHHHHHHGGGcEEEcccHHHHHHHHHHHTTccTTcccHHHHTHHHHHHHHHGGGccEEcccTHHHHHHTTcccEEEEEHHHHHHHHHHHHHHTccccEEEEccTTcEEEEEEEEEccTTcccHHHHHHHHHHHHcHHHHHHHHHHHccEEccTTTGGGccHHHHTcTTTcccHHHHTTEEccccccHHHHHHHHHHHHHHHHcc DISOP:02AL 1-6| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHccEEEEEEcccHHHHHHHHHHccccccEEEEcHHHHHHHHHccccccccHHHcccHHHccHHHHHHccccccccEEEEEEEEEEEEEEEEHHHHHHccccccccccHHHHHcHHHHcccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccEEccHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHcccccEEEEEcccccEEEEEEEEEEcccccHHHHHHHHHHHccHHHHHHHHHHHccccccHHHHHHccHHHHHcccccccHHHHHcccccccccHHHHHHHHHHHHHHHHcc //