[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39326.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:109 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   64->88 PF03626 * COX4_pro 0.00021 50.0 24/83  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39326.1 GT:GENE ABE39326.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2341653..2341982) GB:FROM 2341653 GB:TO 2341982 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39326.1 GB:DB_XREF GI:91683024 LENGTH 109 SQ:AASEQ MKNHRLTLPGDEDHHVLPFQPRIPPSAALAHGRQLPPVQADLSRYEHGGDESHDDFRHRMLTNIAGMVLTVILTAIGFWLATSISDLSKTQDCVLMGRRDCANIAILPG GT:EXON 1|1-109:0| HM:PFM:NREP 1 HM:PFM:REP 64->88|PF03626|0.00021|50.0|24/83|COX4_pro| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,44-52| PSIPRED ccccEEEcccccccEEEcccccccccHHHHcccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccc //