[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39348.1
DDBJ      :             TRAP dicarboxylate transporter, DctP subunit
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  310/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:334 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   28->318 2ceyA PDBj 3e-29 29.0 %
:RPS:PDB   26->329 3b50A PDBj 3e-36 27.8 %
:RPS:SCOP  134->263 1h3dA1  c.94.1.1 * 3e-07 10.2 %
:RPS:PFM   39->311 PF03480 * SBP_bac_7 4e-58 46.3 %
:HMM:PFM   30->312 PF03480 * SBP_bac_7 5.9e-109 48.4 281/286  
:BLT:SWISS 25->317 DCTP_RHOCA e-117 67.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39348.1 GT:GENE ABE39348.1 GT:PRODUCT TRAP dicarboxylate transporter, DctP subunit GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2365345..2366349 GB:FROM 2365345 GB:TO 2366349 GB:DIRECTION + GB:PRODUCT TRAP dicarboxylate transporter, DctP subunit GB:PROTEIN_ID ABE39348.1 GB:DB_XREF GI:91683046 InterPro:IPR004682 LENGTH 334 SQ:AASEQ MRKLILSAASAAMLALAGPAAAQSPIVIKFSHVVAPNTPKGLAAEKFKELADKYTEGKVKVEVYPNSQLYKDKEELDALQLGAVQMLAPSISKFGPAGVKEFEVFDLPYILPDIAALRKVTTGPVGTKLFKLLDAKGMTGLAYWDNGFKIMSANKKLVTPEDYKGLKFRIQSSKVLDAQFRSLGAIPQVMAFSEVYQALQTGVVDGQENTPSNMYTQKMHEVQKYTTLTNHGYIGYAVIVNKKFWDGIPAEIRTQLDKAMVEATDFGNSQSQKENDDALAEMKKSGKTELITLTPEQNSAMRKAMAPVYDDVSGRIGKGLIEEFLKESGGGPTK GT:EXON 1|1-334:0| BL:SWS:NREP 1 BL:SWS:REP 25->317|DCTP_RHOCA|e-117|67.9|293/333| SEG 6->24|lsaasaamlalagpaaaqs| BL:PDB:NREP 1 BL:PDB:REP 28->318|2ceyA|3e-29|29.0|286/306| RP:PDB:NREP 1 RP:PDB:REP 26->329|3b50A|3e-36|27.8|299/310| RP:PFM:NREP 1 RP:PFM:REP 39->311|PF03480|4e-58|46.3|268/284|SBP_bac_7| HM:PFM:NREP 1 HM:PFM:REP 30->312|PF03480|5.9e-109|48.4|281/286|SBP_bac_7| GO:PFM:NREP 2 GO:PFM GO:0006810|"GO:transport"|PF03480|IPR018389| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF03480|IPR018389| RP:SCP:NREP 1 RP:SCP:REP 134->263|1h3dA1|3e-07|10.2|127/220|c.94.1.1| OP:NHOMO 917 OP:NHOMOORG 316 OP:PATTERN --1-------------------------1--------------------------------------- -------1111--------------2------------------1-1-------1-----------1--------------------------1----------1-----------------------------------------------------------1---------------------2122---1---------------841111---13416--------1---------------------1----------------------------------------------------------------------71-----------------------2--11--66-211--31-----2-----11--------D8A--133222----------4-22922A234---1661215433AC642-184B669CA8A--------2----4-2-----------------------------------1D96B2222211----2231-----2213433212---B-74459I8E5212----12----------144-4C193651-5333-1111-111-1111---4111---------1--------22--------221-2-511212-1-122111--111----22-------21--11-1--3133322--212323141-22111116---1111-3-323223333-3-222---1122--111111111111--------------11CI---816-2322-446-------11-1-4444-112711127121------------142222232334--11111---------2-11---------------------------------------------12121--- --------------------------------------------------------------------------------------------------------------------------------------------------------------4----1---------1--------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 304 STR:RPRED 91.0 SQ:SECSTR #########################EEEEEEccccTTcHHHHHHHHHHHHHHHHTTTcEEEEEEcTTTTccHHHHHHHHHHTcccEEEEcGGGGGGTTcGGGGGGGcTTTccHHHHHHHHHccHHHHHHHHHHHHHcEEEEEEEEEEEEEEEEccccccGGGGTTcEEEEcccHHHHHHHHHTTcEEEEccGGGHHHHHHTTcccEEEEEHHHHHHTTGGGcccEEEcccccEEEEEEEEEHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTcEEcEEEccccHHHHHHTHHHHHHHHHHHHHHHHHTcccccc##### DISOP:02AL 1-7,330-335| PSIPRED cHHHHHHHHHHHHHHHcccccccccEEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHHccEEEEEcccccccccccHHHHHHccccccccHHHHHHHHccHHHHHHHHHHHHcccEEEEEEccccEEEEEccccccHHHHcccEEEEEccHHHHHHHHHcccEEEEccHHHHHHHHHcccccEEEccHHHHHHcccHHcccEEEccccccccEEEEEEHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccc //