[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39353.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:117 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39353.1 GT:GENE ABE39353.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2370269..2370622) GB:FROM 2370269 GB:TO 2370622 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE39353.1 GB:DB_XREF GI:91683051 LENGTH 117 SQ:AASEQ MMAPTHEAFLLRQKINYLQALFEGDFSSSSPERAAQEGLARLIAKAAGWKAVGSTYQHETKGSYLIREMDGWSDLCMIECLAVEDWIEKITPPPPLRNILPILRDRENYLNGNGSAS GT:EXON 1|1-117:0| SEG 90->106|itpppplrnilpilrdr| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 55 STR:RPRED 47.0 SQ:SECSTR ###########TTTTEEEEEEcccGGGTTTEEEEEEE##EEEcccTTccEEEEEEEEEEEcccccccH################################################# DISOP:02AL 1-4,27-37,110-118| PSIPRED ccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHcHHHHcccccccc //