[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39370.1
DDBJ      :             DedA family protein
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  506/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
:202 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   29->159 PF09335 * SNARE_assoc 6e-13 41.5 %
:HMM:PFM   30->160 PF09335 * SNARE_assoc 1.4e-27 31.4 118/123  
:BLT:SWISS 1->178 APL_LACLA 5e-27 33.1 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39370.1 GT:GENE ABE39370.1 GT:PRODUCT DedA family protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2393267..2393875) GB:FROM 2393267 GB:TO 2393875 GB:DIRECTION - GB:PRODUCT DedA family protein GB:PROTEIN_ID ABE39370.1 GB:DB_XREF GI:91683068 LENGTH 202 SQ:AASEQ MFDWIVSGIEKAGAIGVFLLMLAENIFPPIPSEVVMPLAGYVASRGDLDIYAVVFAGTLGSLIGTTVWYYAGRTLGSERLRIFAIRHGRWLTMTPEEIDRAAVWFDRYGTWAVLLGRLIPGVRTLISLPAGITGMPILRFISYSAVGTALWTAALAVAGYGMGQNYARIGRFVEPVSNWLLILAAAVYAYRVVTFGHKRDRR GT:EXON 1|1-202:0| BL:SWS:NREP 1 BL:SWS:REP 1->178|APL_LACLA|5e-27|33.1|178/214| TM:NTM 5 TM:REGION 8->30| TM:REGION 47->69| TM:REGION 110->132| TM:REGION 140->162| TM:REGION 175->197| RP:PFM:NREP 1 RP:PFM:REP 29->159|PF09335|6e-13|41.5|118/119|SNARE_assoc| HM:PFM:NREP 1 HM:PFM:REP 30->160|PF09335|1.4e-27|31.4|118/123|SNARE_assoc| OP:NHOMO 898 OP:NHOMOORG 529 OP:PATTERN ------1111111111-1-------------1----------11-----------------121--11 223121112222112------111-1------11111-12221-3111121113322---2241224-32--22222211113----11111--11----------1211--------------122112112222111-----121122--2--22111111-2-3123-111111111111123-----3-355555555254576511332355534311433333335221111111111111131112-1-1-1-11111122---12--2222--------11----------------------------------1--12-----11---2111-4661----1--2222322----22121---1-11--1-----2-1--2----1-21111111111--11-21-1111-------1-1--1--------1-------111111113111--1--------------------------------111-21112111111-----1121------113111211222---121-1--122-1112211111111----111-------11---112221222-13323---1211111111-1-2-------1132211--2-------1-1--1---1111-1--1--1--1111------23232232222222222-2223222222222222222222321112321222222222212322222223-222222222222112-11111----1--1-111--1-----1---------211-1-23221-1221112-1111----1---------1111-----------------------222222---------1-------------------------------------11 --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------11-D------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 202-203| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //