[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39374.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:193 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   16->39 PF00093 * VWC 0.001 20.8 24/57  
:PROS 1->116|PS00430|TONB_DEPENDENT_REC_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39374.1 GT:GENE ABE39374.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2398141..2398722) GB:FROM 2398141 GB:TO 2398722 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE39374.1 GB:DB_XREF GI:91683072 InterPro:IPR010916 LENGTH 193 SQ:AASEQ MPGRLCRTDGTQGPSSRHIVVPIPCDECRCATYRDGCIRYDNRSARSGTNAVMSITTKKQTLTGRLRGSIAIFLLVSQIGLGFLHLANSDHLSDVATSRSIVAMVLPLDSLSVHPPEAGVPTTTLKSILANTPRPDGDGLSLADPHCHECFSANIVVLSSMSTPGPRLAAPDVSRQRQMPDNFVALDTPPPKA GT:EXON 1|1-193:0| PROS 1->116|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| HM:PFM:NREP 1 HM:PFM:REP 16->39|PF00093|0.001|20.8|24/57|VWC| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,191-194| PSIPRED cccccccccccccccccEEEEEEcccccEEccccccEEEEccccccccccEEEEEEEcccEEEEEEcccEEEEEHHHHHccEEEEEccccHHHHHHHcccEEEEEEEccccccccccccccHHHHHHHHcccccccccccccccccHHHHccccEEEEEccccccccccccccHHHHcccccEEEEccccccc //