[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39375.1
DDBJ      :             regulatory protein, MarR
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:173 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   51->146 2fbhA PDBj 3e-05 25.5 %
:RPS:PDB   29->150 3bddA PDBj 9e-11 17.6 %
:RPS:SCOP  28->151 2fbhA1  a.4.5.28 * 3e-12 21.3 %
:HMM:SCOP  23->162 1jgsA_ a.4.5.28 * 1.5e-18 27.2 %
:HMM:PFM   67->113 PF01047 * MarR 2.2e-06 29.8 47/59  
:HMM:PFM   6->50 PF04285 * DUF444 0.00057 31.8 44/421  
:BLT:SWISS 52->125 YUSO_BACSU 7e-06 31.0 %
:PROS 40->56|PS00216|SUGAR_TRANSPORT_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39375.1 GT:GENE ABE39375.1 GT:PRODUCT regulatory protein, MarR GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2399456..2399977 GB:FROM 2399456 GB:TO 2399977 GB:DIRECTION + GB:PRODUCT regulatory protein, MarR GB:PROTEIN_ID ABE39375.1 GB:DB_XREF GI:91683073 InterPro:IPR000835 InterPro:IPR005829 LENGTH 173 SQ:AASEQ MRHGPPEFDPMDVGFTNCGDKTKRSDKHLMWNLMAVSSSLVRVAELLGRRLGITGSQWLLLEAIRFLSRGDGVPVGEAAALLDVKGSFISFQARSLEERGFLCRKQSGRDKRVFLLSLTENAEAKLGSLEAVLFSIEPLLRGGLDDDAIRETANRLDGMRRRLARARGRAKEN GT:EXON 1|1-173:0| BL:SWS:NREP 1 BL:SWS:REP 52->125|YUSO_BACSU|7e-06|31.0|71/155| PROS 40->56|PS00216|SUGAR_TRANSPORT_1|PDOC00190| SEG 155->170|rldgmrrrlarargra| BL:PDB:NREP 1 BL:PDB:REP 51->146|2fbhA|3e-05|25.5|94/137| RP:PDB:NREP 1 RP:PDB:REP 29->150|3bddA|9e-11|17.6|119/138| HM:PFM:NREP 2 HM:PFM:REP 67->113|PF01047|2.2e-06|29.8|47/59|MarR| HM:PFM:REP 6->50|PF04285|0.00057|31.8|44/421|DUF444| RP:SCP:NREP 1 RP:SCP:REP 28->151|2fbhA1|3e-12|21.3|122/137|a.4.5.28| HM:SCP:REP 23->162|1jgsA_|1.5e-18|27.2|136/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 15 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-2---31421------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 133 STR:RPRED 76.9 SQ:SECSTR ###################HHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEccccTTcEEEEEcHHHHHHHTTcccHHHHHHHHHHTcccHHHHHHH##################### DISOP:02AL 1-4,164-174| PSIPRED cccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccc //