[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39376.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:128 amino acids
:PSIPRED
:DISOPRED
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39376.1 GT:GENE ABE39376.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2400117..2400503 GB:FROM 2400117 GB:TO 2400503 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE39376.1 GB:DB_XREF GI:91683074 LENGTH 128 SQ:AASEQ MVGNLGNRETRLSLFLRYIGQGLLRSSRNALVWAVMTAYLIAGILHGVDHLDLASSKVQVVVAIGDKGDAVPDKADVAGQHCHGCFSVAIADHAVTPPKLDASGPTGIARNMPPPGERRGIDPPPPKT GT:EXON 1|1-128:0| TM:NTM 1 TM:REGION 24->46| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,105-129| PSIPRED cccccccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHcEEccccccEEEEEcccccccccHHHHcccccccEEEEEEcccccccHHHHHHccccccccccccccccccccccccc //