[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39388.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:204 amino acids
:PSIPRED
:DISOPRED
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39388.1 GT:GENE ABE39388.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2411391..2412005) GB:FROM 2411391 GB:TO 2412005 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE39388.1 GB:DB_XREF GI:91683086 LENGTH 204 SQ:AASEQ MQATGLPRIVRPPRPPRPVKPSTSSAHAPAPPMALPRPPTPAPRPPDVDPMSTLSQLEQRRETSTIEYDDEGRRIMTEPLASPPRPATTILHPPGSGNTAPARPVLPPVRAHFVLGARRPPVPPAPRHLTTEQKAAWYADQESKIDAMLAQREADKAAAKKAEAEKRAAQRAAWQERVSRTIPRRRPAAEPKKAPLLTPDDIPF GT:EXON 1|1-204:0| COIL:NAA 34 COIL:NSEG 1 COIL:REGION 140->173| SEG 7->52|privrpprpprpvkpstssahapappmalprpptpaprppdvdpms| SEG 100->111|aparpvlppvra| SEG 117->127|arrppvppapr| SEG 150->177|aqreadkaaakkaeaekraaqraawqer| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,8-8,16-33,152-173,182-192| PSIPRED cccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccEEEcccccEEcccccccccccccEEEccccccccccccccccccHHHHEEccccccccccccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccc //