[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39396.1
DDBJ      :             ATP dependent DNA ligase
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  175/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.40.4d.142.2
:313 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   123->309 1vs0A PDBj 1e-14 31.3 %
:RPS:PDB   6->249 1cknB PDBj 3e-28 13.8 %
:RPS:SCOP  23->206 1fviA2  d.142.2.1 * 1e-24 13.5 %
:RPS:SCOP  210->309 1a0iA1  b.40.4.6 * 2e-10 17.4 %
:HMM:SCOP  20->206 1a0iA2 d.142.2.1 * 2.7e-50 37.6 %
:HMM:SCOP  207->310 1a0iA1 b.40.4.6 * 3.9e-15 34.0 %
:RPS:PFM   38->206 PF01068 * DNA_ligase_A_M 4e-15 32.1 %
:HMM:PFM   38->206 PF01068 * DNA_ligase_A_M 7.6e-30 30.8 169/202  
:HMM:PFM   222->309 PF04679 * DNA_ligase_A_C 2.6e-22 37.5 88/96  
:BLT:SWISS 26->309 Y963_MYCBO 1e-19 29.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39396.1 GT:GENE ABE39396.1 GT:PRODUCT ATP dependent DNA ligase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2415919..2416860) GB:FROM 2415919 GB:TO 2416860 GB:DIRECTION - GB:PRODUCT ATP dependent DNA ligase GB:PROTEIN_ID ABE39396.1 GB:DB_XREF GI:91683094 InterPro:IPR012309 InterPro:IPR012310 LENGTH 313 SQ:AASEQ MAKRARVVRIHAEGAVPAPMPGFVQPQLATLRTRPPSGAGWIHEIKLDGYRGQAHVGPQGTRIYTRGGHDWSKMFAPLVAALSDAAVDEAVIDGEIVVVVDERTDFGALQADLAARRADRMLFYAFDLLHLDGYDLGPVPLTERKRLLKGLFDRGLEPPVVYSDSMDDGEAMFDGAGRLGWEGIVSKRADAPYRSGDRSLDWQKIKTSKREHLVIVGYVPATGGIAALHVARRDGDSLVYAGKVGTGFSVKVGADLRRRLAEIETAAPPIAKPPPRHRPRWVRPVMSADVEYRDITASGHLRHASFKGLAKAP GT:EXON 1|1-313:0| BL:SWS:NREP 1 BL:SWS:REP 26->309|Y963_MYCBO|1e-19|29.4|279/759| SEG 87->102|vdeavidgeivvvvde| SEG 108->120|alqadlaarradr| SEG 266->285|aappiakppprhrprwvrpv| BL:PDB:NREP 1 BL:PDB:REP 123->309|1vs0A|1e-14|31.3|179/294| RP:PDB:NREP 1 RP:PDB:REP 6->249|1cknB|3e-28|13.8|217/316| RP:PFM:NREP 1 RP:PFM:REP 38->206|PF01068|4e-15|32.1|168/201|DNA_ligase_A_M| HM:PFM:NREP 2 HM:PFM:REP 38->206|PF01068|7.6e-30|30.8|169/202|DNA_ligase_A_M| HM:PFM:REP 222->309|PF04679|2.6e-22|37.5|88/96|DNA_ligase_A_C| GO:PFM:NREP 5 GO:PFM GO:0003910|"GO:DNA ligase (ATP) activity"|PF01068|IPR012310| GO:PFM GO:0005524|"GO:ATP binding"|PF01068|IPR012310| GO:PFM GO:0006260|"GO:DNA replication"|PF01068|IPR012310| GO:PFM GO:0006281|"GO:DNA repair"|PF01068|IPR012310| GO:PFM GO:0006310|"GO:DNA recombination"|PF01068|IPR012310| RP:SCP:NREP 2 RP:SCP:REP 23->206|1fviA2|1e-24|13.5|171/184|d.142.2.1| RP:SCP:REP 210->309|1a0iA1|2e-10|17.4|92/101|b.40.4.6| HM:SCP:REP 20->206|1a0iA2|2.7e-50|37.6|186/0|d.142.2.1|1/1|DNA ligase/mRNA capping enzyme, catalytic domain| HM:SCP:REP 207->310|1a0iA1|3.9e-15|34.0|100/0|b.40.4.6|1/1|Nucleic acid-binding proteins| OP:NHOMO 272 OP:NHOMOORG 180 OP:PATTERN -----------------------1-------------------------------1---11-----1- 113-2---------13311-11--1111111123243253-1---1---1--111-----112--111------------1------------------2-1-1-311-1--------------1---------------------------------------------------------------11---1--------------------------------------------------------------------------------------------------------------------------------------------------------1----1---111-111---111--------1--3-----1241231111211----------1---------181--5513434534611------1111------------11-----------------------------------112---1--1112111-----21131111---21222---11--111-1-1-1----1--1-----------111-1--------------111---1--1121-2---------------------------------------------------------------------------------------------------------------------------------------------------------------1-111------------------------------------11111-11111111111------------------------2112122----------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 304 STR:RPRED 97.1 SQ:SECSTR #####HHHHHHHTccccccccccEEEEEccGGGHHHHHTccEEEEEEccEEEEEEETEEEEEEEETTccEEEcccccccGGGGGccTTEEEEEEEEEEccccTTcEEEEEEEEEcTTTccEEEEEEEEEEETTEEcTTccHHHHHHHHHHHTcccEcccEETTcHHHHHHHHHHHHTTccEEEEEEEEcccccccEcEEEEEEEEcTccEEEEEEEETTTEEEETTEEEEEEGGGTEEEEEEEccccccTTEEEEEEEcTTTTccccccccccTTTTcEEEccTTcEEEEEEcEEcTTccEEccEEEEE#### DISOP:02AL 1-18,313-314| PSIPRED ccccccccccccccccccccccccccccccccccccccccEEEEEEEccEEEEEEEEccEEEEEEccccHHHHHHHHHHHHHHccccccEEcccEEEEEEEcccccHHHHHHHHHHcccEEEEEEEEccccccEEcccccHHHHHHHHHHHHHccccccEEEEccHHHHHHHHHHHHHccccEEEEEccccccccccccccEEEEEEccEEEEEEEEEEcccccEEEEEEEEEEccEEEEEEEccccccHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEEEEccccccccEEcHHHHHHcccc //