[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39402.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.2
:209 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  90->161 1d6uA3  d.17.2.1 * 6e-04 19.1 %
:HMM:PFM   38->78 PF00775 * Dioxygenase_C 0.00099 26.8 41/183  
:BLT:SWISS 41->85 YPJI_ECOLI 3e-04 45.5 %
:BLT:SWISS 114->184 MIAB_THEFY 2e-04 31.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39402.1 GT:GENE ABE39402.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2419918..2420547 GB:FROM 2419918 GB:TO 2420547 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE39402.1 GB:DB_XREF GI:91683100 LENGTH 209 SQ:AASEQ MIIFNLTSQAKTRIATAIRTIDGDEPLLSGAIGRRAKTDAPIILAGVIDVWPADSDGIHRVALSDAAGAVVWRAFAVTEITAGRGRLKAVDEYTALFGIRHPEPAYEYVCAQMKGRGIRPCSDVDHDDWAEATRWVVADGGTRDPRRSWAKSAWRGRAVAHEAYAQAGLTLPMLGTWDPRPSILFVTPSPEPVRPSMSLEDDAALADLA GT:EXON 1|1-209:0| BL:SWS:NREP 2 BL:SWS:REP 41->85|YPJI_ECOLI|3e-04|45.5|44/90| BL:SWS:REP 114->184|MIAB_THEFY|2e-04|31.0|71/494| SEG 199->208|leddaaladl| HM:PFM:NREP 1 HM:PFM:REP 38->78|PF00775|0.00099|26.8|41/183|Dioxygenase_C| RP:SCP:NREP 1 RP:SCP:REP 90->161|1d6uA3|6e-04|19.1|68/115|d.17.2.1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 6-7| PSIPRED cEEEEEcccHHHHHHHHHEEcccccccccccccccccccccEEEEEEEEEcccccccEEEEEEcccccEEEEEEEEEEEEEccccEEEHHHHHHHHHccccccHHHHHHHHHHccccccccccccHHHHHHHHEEEEcccccccHHHHHHHHHcccHHHHHHHHHHccccccccccccccccEEEEcccccccccccccccHHHHHccc //