Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39406.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:99 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39406.1 GT:GENE ABE39406.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2423335..2423634 GB:FROM 2423335 GB:TO 2423634 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE39406.1 GB:DB_XREF GI:91683104 LENGTH 99 SQ:AASEQ MRLAMSKLIGICNQSLEVFDVRDASIDQDDAIGAAKALDIDRGIDGLNPKYRIVSELWDRDSGYIIASVDDSVDTENSAAVEEAIADAGYYYVATSYDI GT:EXON 1|1-99:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccHHHHHHHHHHHccEEEEEEccccccccccccHHHcccHHHcccccccHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHcccEEEEEEEccc //