Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39411.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:212 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39411.1 GT:GENE ABE39411.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(2428334..2428972) GB:FROM 2428334 GB:TO 2428972 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE39411.1 GB:DB_XREF GI:91683109 LENGTH 212 SQ:AASEQ MIRARRLRIPGQLSRQAHNREFTRAVPFERKTGAHLGDDRQAEKRSAAENVQAPPGGATTNNGADAKMNRLIMTPIIGLLVATASAEPIDPSRIRVIDGDTIRVDRRLPYQRLGWLQSARNPSSKDSLRARARRPATARLGEIIQASKLDYTKVPCSCRLGTEGTMPCNFRRRRGALKANGVDVGEIPRKEGLAVRSLCGPTSYPKTPTPWR GT:EXON 1|1-212:0| SEG 129->139|rararrpatar| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,36-58,118-134,206-213| PSIPRED ccccEEccccHHHHHHHcccHHHHccccccccccccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHccccccccHHHEEEEcccEEEEEccccHHHHHHHHHccccccHHHHHHHHccccHHHHHHHHHHHcccccccccccccccccccccccHHHccccccccccHHHcccccccEEHHHcccccccccccccc //