[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE39415.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:125 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   52->65 PF05924 * SAMP 0.00031 61.5 13/20  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE39415.1 GT:GENE ABE39415.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 2434570..2434947 GB:FROM 2434570 GB:TO 2434947 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE39415.1 GB:DB_XREF GI:91683113 LENGTH 125 SQ:AASEQ MASQILDLIPHTVLAGRTARTAAARSSELGVQIMTMGQLAARLAGGLLRPVDLEVLQEAISAALPVVDMGDWSDRAAARDAGRGDGDLRQDVAGGRRPFGGDTSPAGGWRLAPWSRRWSSGCRRR GT:EXON 1|1-125:0| SEG 15->25|agrtartaaar| SEG 39->49|laarlaggllr| SEG 74->87|draaardagrgdgd| SEG 114->124|wsrrwssgcrr| HM:PFM:NREP 1 HM:PFM:REP 52->65|PF05924|0.00031|61.5|13/20|SAMP| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,78-86,123-126| PSIPRED cHHHHHHHccHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccEEcccccHHHHHHHccccccHHHHHHHcccccccccccccccEEcccHHHHHHHccccc //